DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and CCND1

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_444284.1 Gene:CCND1 / 595 HGNCID:1582 Length:295 Species:Homo sapiens


Alignment Length:305 Identity:70/305 - (22%)
Similarity:120/305 - (39%) Gaps:83/305 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 PRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIY 426
            |.||.|:..|::||||..|...|.|.||::||||:|.: ..|:|:.|||:|.||:|||:|::|..
Human    54 PSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSL-EPVKKSRLQLLGATCMFVASKMKETI 117

  Fly   427 PPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVYMQLNVNNRTPASFSQ--I 489
            |....:....||.:....::|..|.:|:..|.|:::.:                 ||..|.:  :
Human   118 PLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAM-----------------TPHDFIEHFL 165

  Fly   490 GRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGMANYSYSVLAAAAISHTFSREMALRCSG 554
            .:...||.:...|......|        :.||..||...:...|::||.::              
Human   166 SKMPEAEENKQIIRKHAQTF--------VALCATDVKFISNPPSMVAAGSV-------------- 208

  Fly   555 LDWQVIQPCARWMEPFFRVISQKAPYLQLNEQNEQVSNKFGLGLICPNIVTDDSHIIQTHTTTMD 619
                                               |:...||.|..||      :.:..:..|..
Human   209 -----------------------------------VAAVQGLNLRSPN------NFLSYYRLTRF 232

  Fly   620 MYDEVLMAQDAAHAMRARIQASPATALRAPESLLTPPASSHKPDE 664
            :...:....|...|.:.:|:|...::||..:..:.|.|:..:.:|
Human   233 LSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 40/99 (40%)
Cyclin_C <517..>571 CDD:281044 7/53 (13%)
CCND1NP_444284.1 CYCLIN_CCND1_rpt1 3..151 CDD:410276 39/97 (40%)
CYCLIN_CCND1_rpt2 156..265 CDD:410279 27/171 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..295 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.