DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccnd1

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_008758390.1 Gene:Ccnd1 / 58919 RGDID:68384 Length:317 Species:Rattus norvegicus


Alignment Length:351 Identity:81/351 - (23%)
Similarity:131/351 - (37%) Gaps:122/351 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 PRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIY 426
            |.||.|:..|::||||..|...|.|.||::||||:|.: ..::|:.|||:|.||:|||:|::|..
  Rat    54 PSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSL-EPLKKSRLQLLGATCMFVASKMKETI 117

  Fly   427 PPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVYMQLNVNNRTPASFSQIGR 491
            |....:....||.:....::|..|.:|:..|.|:::.:                 ||..|.:...
  Rat   118 PLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAM-----------------TPHDFIEHFL 165

  Fly   492 QKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGMANYSYSVLAAAAI---------------- 540
            .|..|||:.....:.....||.      ||..||...:...|::||.::                
  Rat   166 SKMPEADENKQIIRKHAQTFVA------LCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFL 224

  Fly   541 -----SHTFSREMALRC-------SGLDWQVIQPCARWMEPFFRVISQKAPYLQLNEQNEQVSNK 593
                 :|..||  .::|       :||          |:                        ||
  Rat   225 SCYRTTHFLSR--VIKCDPVKALATGL----------WL------------------------NK 253

  Fly   594 FGLGLICPNIVTDDSHIIQTHTTTMDMYDEVLMAQDAAHAMRARIQASPATALRAPESLLTPPAS 658
            ..|.|..|                         .||...|.:.:|:|...::||..:..:.|.|:
  Rat   254 DSLHLRPP-------------------------LQDCLRACQEQIEALLESSLRQAQQNIDPKAT 293

  Fly   659 SHKPDEYLGDEGDETGARSGISSTTT 684
                     :|..|....:|::.|.|
  Rat   294 ---------EEEGEVEEEAGLACTPT 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 39/99 (39%)
Cyclin_C <517..>571 CDD:281044 14/81 (17%)
Ccnd1XP_008758390.1 Cyclin_N 31..153 CDD:278560 39/99 (39%)
Cyclin_C 156..291 CDD:281044 35/201 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340027
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.