DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and ccnd2b

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_005164578.1 Gene:ccnd2b / 565038 ZFINID:ZDB-GENE-050420-354 Length:330 Species:Danio rerio


Alignment Length:251 Identity:59/251 - (23%)
Similarity:103/251 - (41%) Gaps:41/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 LQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEE 424
            :||.||.::..|::||||..|...:.|.||::||||:| .|...:|.:|||:|..|||:|:|::.
Zfish    85 IQPFMRKMVATWMLEVCEEEKCEDDVFPLAMNYLDRFL-AAVPTRKCYLQLLGAVCLFLASKLKA 148

  Fly   425 IYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVYMQLNVNNRTPASFSQI 489
            ..|....:....||.:.|.:.:|..|.::|..|.|:::.|                 ||..|.:.
Zfish   149 CQPLSARKLCMYTDNSITSQQLLEWELVVLSKLKWNLAAI-----------------TPLDFIEH 196

  Fly   490 GRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGMANYSYSVLAAAAISHTFS--------- 545
            ...|....:|.....:      ..|...:.||..|.....|..|::|...:.....         
Zfish   197 ILHKLPFHEDRLTLIR------KHTQTFIALCATDHSFTMYPPSMIATGCVGAAVCGLQSSQSNQ 255

  Fly   546 -------REMALRCSGLDWQVIQPCARWMEPFFR-VISQKAPYLQLNEQNEQVSNK 593
                   .|:..:.:..:...::.|...:|.... .:.:.....|..:|:.:.|||
Zfish   256 SLWGDNLMELLAKITNTELDCLKSCQEQIEQLLTDSLKESQQQHQQQQQDGRASNK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 38/101 (38%)
Cyclin_C <517..>571 CDD:281044 9/69 (13%)
ccnd2bXP_005164578.1 Cyclin_N 60..186 CDD:278560 38/101 (38%)
Cyclin_C 189..>291 CDD:281044 15/107 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.