DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and ccnj

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_021336586.1 Gene:ccnj / 557593 ZFINID:ZDB-GENE-100721-4 Length:355 Species:Danio rerio


Alignment Length:300 Identity:55/300 - (18%)
Similarity:117/300 - (39%) Gaps:79/300 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 AADVWRLMCHRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDR 395
            |.|:::.:.:::     ||..:...|.|.|.  :|....|.:..|...:||.....:|||..||.
Zfish    13 AEDIYQALRYKE-----LRLPAYKGQSPQLS--LRRYFADLIAIVSNRFKLCPAARHLAVYLLDL 70

  Fly   396 YLHVAHKVQKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGAC--------TERDILNHEKI 452
            ::. .:.:....|.::.::||.:|:|.|| ...::.:...:....|        |:..:|:.|.:
Zfish    71 FMD-RYDISVQQLHMVALSCLLLASKFEE-REDRVPKLEALNSLGCMSSMNLVLTKPGLLHMELL 133

  Fly   453 LLQALDWDISPITITGWLGVYMQLNVNNRT-----PASFSQIGRQKSAEADDAFIYPQFSGFEFV 512
            ||:...|::...|...::..|:.:.||...     |.:..:......::..|.|           
Zfish   134 LLETFQWNLYLPTAAHFIEYYLPVAVNETDLHDGWPMTCMEKTMLYMSKYADYF----------- 187

  Fly   513 QTSQLLDLCTLDVGMANYSY-----SVLAAAAISHTFSREMAL-----------RCSGLDWQVIQ 561
                      |:|.:.::::     |:::||.::   |..:.|           |.|...|:.:.
Zfish   188 ----------LEVSLQDHAFLRFVPSLVSAACVA---SSRVILRLSPSWPPRLQRLSAYSWEQLL 239

  Fly   562 PCARWMEPFFRVISQKAPYLQLNEQNEQVSNKFGLGLICP 601
            ||.:.:     :|:..:...:.|:|.            ||
Zfish   240 PCVQKL-----LIAHDSDVKEANKQK------------CP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 30/136 (22%)
Cyclin_C <517..>571 CDD:281044 12/69 (17%)
ccnjXP_021336586.1 Cyclin_N2 <10..246 CDD:330468 50/270 (19%)
Cyclin_C 145..>249 CDD:308564 20/132 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.