DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and ccne2

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001016267.1 Gene:ccne2 / 549021 XenbaseID:XB-GENE-923043 Length:397 Species:Xenopus tropicalis


Alignment Length:344 Identity:140/344 - (40%)
Similarity:198/344 - (57%) Gaps:44/344 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 LRQCPLPALAWANAADVWRLMCHRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLH 382
            :.:.|||.|:|.|:.|||..|..::.:  .:.|..:|:.||.|.|.||:|||||||||.|||.||
 Frog    96 ISRSPLPELSWGNSKDVWMKMISKESR--YVHSSRLLQNHPTLNPDMRSILLDWLIEVSEVYTLH 158

  Fly   383 RETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGACTERDIL 447
            |||||||.|:.||::.....|.|:.|||||:|.||:|:|:|||||||:.||||||||||:|.|||
 Frog   159 RETFYLAQDFFDRFMLTQTCVNKSMLQLIGVTALFIASKLEEIYPPKLHEFAYVTDGACSEDDIL 223

  Fly   448 NHEKILLQALDWDISPITITGWLGVYMQLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEFV 512
            ..|.|:|:||.|::.|:|...||.:|:|::                |.:.....:.||:|..:|:
 Frog   224 QMELIMLKALKWELYPVTAIAWLNLYLQVS----------------SLKDHPKLLLPQYSQEQFI 272

  Fly   513 QTSQLLDLCTLDVGMANYSYSVLAAAAISHTFSREMALRCSGLDWQVIQPCARWMEPFFRVISQK 577
            ...||||||.|.....::.|.:|||||:.|..|.|:..:.:|||.:.|..|..||.||.||:.:.
 Frog   273 HVVQLLDLCILHHTSLDFQYRILAAAALYHFTSTEVVTKATGLDMESIGECVHWMAPFARVVKRS 337

  Fly   578 APYLQLNEQNEQVSNKFGLGLICPNIVTDDSHIIQTHTTTMDMYDEVLMAQDAAHAMRARIQASP 642
            :|: :|.              :...:..:|.|.||||...:||.|:|.:..       :.:..||
 Frog   338 SPF-KLK--------------VFKKVAPEDMHNIQTHANYLDMLDDVKVPD-------SDLGESP 380

  Fly   643 ATALRAPESLLTPPASSHK 661
            .    |...:||||.|:.|
 Frog   381 V----AIGGILTPPKSTEK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 75/128 (59%)
Cyclin_C <517..>571 CDD:281044 23/53 (43%)
ccne2NP_001016267.1 Cyclin_N 111..237 CDD:365896 75/127 (59%)
Cyclin_C 240..359 CDD:367282 43/149 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 158 1.000 Domainoid score I4064
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0002994
OrthoInspector 1 1.000 - - otm48377
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2444
SonicParanoid 1 1.000 - - X2342
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.