DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and ccng1

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001006698.1 Gene:ccng1 / 448326 XenbaseID:XB-GENE-922065 Length:295 Species:Xenopus tropicalis


Alignment Length:258 Identity:63/258 - (24%)
Similarity:100/258 - (38%) Gaps:61/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 LPALAWANAADVWRLMCHRDEQDSRLRSISMLEQHPGLQP----------------RMRAILLDW 371
            :..|..:||.|   |:|..:         |:||.....||                ||...|.|:
 Frog     2 IETLVTSNAQD---LLCQLN---------SLLELELKCQPKACGLRLIESTHDNGLRMTTKLRDF 54

  Fly   372 ----LIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKV--EEIYPPKI 430
                |:.:.:.:....|||.|:|:.|||:|. ..|||..||..:|:.|.::|.|.  ||...|..
 Frog    55 EVKDLLSLTQFFGFSTETFSLSVNLLDRFLS-KMKVQPKHLGCVGLACFYLAVKAIEEERNVPLA 118

  Fly   431 GEFAYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVYMQLNVNNRTPASFSQIGRQKSA 495
            .:...::....|..|::..|||:|:.|.|.:...|....|.:|..|..:|.|       |.:|..
 Frog   119 TDLLRISQYKFTVFDMMRMEKIVLEKLGWKVKATTALHLLHLYHSLVFDNLT-------GERKKL 176

  Fly   496 EADDAFIYPQFSGFEFVQTSQLLDLCTLDVGMANYSYSVLAAAAISHTFSREM------ALRC 552
            .:.:..:             ..|..|...:|.:....||||.:.::.....:.      ||.|
 Frog   177 FSQERLV-------------THLKACHCRLGFSKAKPSVLALSILALEIQEQKLFELLDALEC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 42/150 (28%)
Cyclin_C <517..>571 CDD:281044 10/42 (24%)
ccng1NP_001006698.1 Cyclin_N 17..149 CDD:365896 39/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.