DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and ccni

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_012814707.1 Gene:ccni / 448195 XenbaseID:XB-GENE-945654 Length:383 Species:Xenopus tropicalis


Alignment Length:208 Identity:57/208 - (27%)
Similarity:100/208 - (48%) Gaps:31/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 GLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAK-V 422
            |:.|..|..::.||.|:...::::.||..||:..|||:| .|.|.:..:|:.|.|:|.|:||| :
 Frog    42 GISPEQRDEVILWLAELKYQFRVYPETHALAISILDRFL-AAVKARPKYLRCIAISCFFLAAKTI 105

  Fly   423 EEIYPPKIGEFAYVTDGA---CTERDILNHEKILLQALDWDISPITITGWLGVYMQLNVNNRTPA 484
            ||  ..:|.....:|.|:   |:..::|..|:|:|..|:||:...|...:|.::..:.: |.:|.
 Frog   106 EE--DERIPVLRVLTQGSSCGCSPAEVLRMERIILDKLNWDLHTATPLDFLHIFHAMTL-NASPE 167

  Fly   485 SFSQIGRQKSAEADDAFIYPQFSGFEFVQ--TSQLLDLCTLDVGMANYSYSVLAAAAISHTFSRE 547
            .|.:|              |:.:..:.|.  |.|||. |.....:..:..|:||.|.:|....:.
 Frog   168 LFDRI--------------PELNPSQHVALLTRQLLQ-CMAFHQLLQFKGSMLALALLSLEMEKL 217

  Fly   548 MALRCSGLDWQVI 560
            :.      ||..:
 Frog   218 LP------DWLAV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 37/106 (35%)
Cyclin_C <517..>571 CDD:281044 10/44 (23%)
ccniXP_012814707.1 CYCLIN_CCNI-like 47..145 CDD:410230 34/100 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.