DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and CycG

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster


Alignment Length:431 Identity:71/431 - (16%)
Similarity:150/431 - (34%) Gaps:136/431 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 EEDDDVEIYSSTISPASSGCSQQQAVNGERTPGLPKHQEQIHHPVSDLMINMRTPMSPAVENGLR 319
            |:...:|..:.:.:.|..|.|..   |||.:..|.|.::|:|...||                  
  Fly   195 EQQQQLEDLAESEAGAVGGASNN---NGESSSSLKKLEDQLHALTSD------------------ 238

  Fly   320 QCPLPALAWANAADVWRLMCHRDEQDSRLRSISMLEQ----------HPGLQPRMRAILLDWLIE 374
                         :::..:...|....:..::.:|.:          ..|....:|.:.: |   
  Fly   239 -------------ELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKM-W--- 286

  Fly   375 VCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDG 439
                |:|..:..:.|:..:||:|. ...|:..|:..:.:....:|.|..::.|....:...::..
  Fly   287 ----YELPSDVLFSAMSLVDRFLD-RMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQC 346

  Fly   440 ACTERDILNHEKILLQALDWDI--SPITITGWLGVYMQLNVNNRTPASFSQIGRQKSAEADDAFI 502
            .||..|:.....::...|...:  :|||...:|.:|..|         |..:.::...:.     
  Fly   347 GCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYAL---------FRNLAKEIGGDF----- 397

  Fly   503 YPQFSGFEFVQTSQLLDL----CTLDVGMANYSYSVLAAAAISHTFSREMALRCSGLDWQVIQPC 563
                  |:|.|  ||:.|    ..|::.|.:...:|:..:.::      :.|.|..||:.:.:..
  Fly   398 ------FKFYQ--QLIKLEELENRLEILMCDVKTTVITPSTLA------LVLICLHLDFHIKESY 448

  Fly   564 AR-------------WMEPFFRVISQ--------------------KAPYLQ-----LNEQNEQV 590
            .|             :::.:.|:..:                    ||||.|     |:.:..:|
  Fly   449 TRGSPELKHVFEYILFLQQYMRIPDRVFTCGFSIVSGILSHYNGQNKAPYKQRLVWKLSSRTLRV 513

  Fly   591 ---SNKFGLGLI-----CPNIVTDDSHIIQTHTTTMDMYDE 623
               .|:|...|.     .||.:.|.   :::.|.::...:|
  Fly   514 LRPINRFSSDLPTIEEGIPNALDDG---LRSRTESISSEEE 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 20/140 (14%)
Cyclin_C <517..>571 CDD:281044 10/70 (14%)
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 14/78 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.