DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccnjl

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001038995.1 Gene:Ccnjl / 380694 MGIID:2685723 Length:387 Species:Mus musculus


Alignment Length:341 Identity:66/341 - (19%)
Similarity:121/341 - (35%) Gaps:88/341 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 ISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITC 415
            :::|.:|..|.|..|                     :||:..||.::...:......|..:.::|
Mouse    45 LTLLSRHCHLCPSAR---------------------HLAIYLLDHFMDQYNITTSKQLYTVAVSC 88

  Fly   416 LFVAAKVE--EIYPPKIGEFAYV-----TDGACTERDILNHEKILLQALDWDISPITITGWLGVY 473
            |.:|:|.|  |...||:.:....     .:.:.|::::|..|.:||:|..||:...|...:|..|
Mouse    89 LLLASKFEDREDRVPKLEQINNTRILSSQNFSLTKKELLTTELLLLEAFSWDLCLPTPAHFLDYY 153

  Fly   474 MQLNVNNRT------PASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGMANYSY 532
            :..:::.:.      |.:.    .:|:.|....:.:            ..|::...|.....:..
Mouse   154 LLASISQKDHHCHAWPTTC----LRKTKECLKEYAH------------YFLEVTLQDHIFYKFQP 202

  Fly   533 SVLAAAAISHTFSREMALRCSGLDWQVIQPCARWMEPFFRVISQKAPYLQL----------NEQN 587
            ||:|||             |.|.....:|....|.....||.|....:|..          |...
Mouse   203 SVVAAA-------------CVGASRICLQLSPYWTRDLQRVSSYSLEHLSTCIEILLVAYDNVLK 254

  Fly   588 EQVSNKFGLGLICPNIVTDDSHII----------QTHTTTMDMYDEVLMAQDAAHAMRARIQASP 642
            :.|:.|.....:.|...:..:.::          |...||:..:..  .|||...|.|..:||..
Mouse   255 DAVAVKSQTLAMVPGSSSAPAQVLFQPPTYPTLSQPPPTTLAQFQS--PAQDLCLAYRDSLQAHR 317

  Fly   643 ATALRAPE---SLLTP 655
            :..|.:.:   ||.||
Mouse   318 SGGLLSGDTGPSLHTP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 26/117 (22%)
Cyclin_C <517..>571 CDD:281044 11/53 (21%)
CcnjlNP_001038995.1 CYCLIN 13..>106 CDD:294043 18/81 (22%)
Cyclin_C 144..>246 CDD:281044 21/130 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836333
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.