DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and CYCJ18

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001030944.1 Gene:CYCJ18 / 3768365 AraportID:AT2G01905 Length:234 Species:Arabidopsis thaliana


Alignment Length:204 Identity:38/204 - (18%)
Similarity:82/204 - (40%) Gaps:40/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 MRAILLDWLIEVCEVYKLHRETFYLAVD-YLDRYL-HVAHKVQK-------------THLQLIGI 413
            :|..|:::||:...:.:|.....|.|:. :.||:. ::...:||             ::|||..:
plant     8 LRRRLVEFLIQSTTLLELPPIVKYSALSLFFDRFRPNLVRFLQKKKAEHWLLQPLNESNLQLFVL 72

  Fly   414 TCLFVAAKVE-----EIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVY 473
            ..::::.|:.     .::..|......:|:.....||.|:.|.:.|:.|.::|..:.|     .|
plant    73 ISIWISCKMHCTRGLSVHSLKSFGDKVITEQLFMVRDFLDAELVFLKVLKFEIGTLNI-----AY 132

  Fly   474 MQLNVNNRTPASFSQIGRQKSAEA------------DDAFIYPQFSGFEFVQTSQLLDLCTLDVG 526
            .:|..........:::|.|.:.||            |.:.:|   ...:.:..|.|:....:.|.
plant   133 TRLEDLLIQFKEVAKVGEQLNFEACMDMMDLLYEKEDTSLLY---QSSKSLAASILVSSYIITVP 194

  Fly   527 MANYSYSVL 535
            ...|.:.:|
plant   195 KQQYEFPIL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 23/117 (20%)
Cyclin_C <517..>571 CDD:281044 4/19 (21%)
CYCJ18NP_001030944.1 CYCLIN <7..126 CDD:381775 23/117 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.