DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccnb3

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_038956227.1 Gene:Ccnb3 / 317389 RGDID:1564367 Length:1405 Species:Rattus norvegicus


Alignment Length:531 Identity:118/531 - (22%)
Similarity:207/531 - (38%) Gaps:157/531 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EPNGSIVTTAPSNGEVSSSIVVVVSSSSISSSSDSPIAILPHPDPIPSTSFSSASQR------SE 76
            |.:|::........|:||..:|.:..|.|:.......|.:        .|:::|::.      |.
  Rat   818 EASGALEEPLNIQEELSSEDIVAIMKSLITEDESIKEAFI--------RSYTTATEAPAEKSLSL 874

  Fly    77 EELPGTSAASRTDEMCSCDSQNLAASTAATS----NGNKRKRRLSSDSNEDPELGFE--PPSAKR 135
            ||......|:..:.:.|.:.......|....    ..|.|..||:        |.|:  |||   
  Rat   875 EETSINEVATLKEPLSSQEKHRAELVTVLKELLVLVKNPRLERLA--------LAFQENPPS--- 928

  Fly   136 QQRLPALYGSEQGNLSSVASSVYTSPVVSVDGQST-------QELLSIRS--SPAEDLSEAPHSP 191
                         |:.::...|......|...:||       ||.||.::  ||.|.|:      
  Rat   929 -------------NVETLLREVLALVEKSTGEESTLNEPLALQEKLSTKAELSPKELLA------ 974

  Fly   192 LPDSPDSPPSPDRGS----------KQTPVVVRYAAEQVVTSTV------------VTQKTEDDD 234
            |.|:|....:..:||          |.....:.::.|:....::            .|::....|
  Rat   975 LEDNPSFKKASPQGSLTFDHKPDIEKDEITRMSFSFEEFSIDSLYEKVLALSEGFTTTEQLSFTD 1039

  Fly   235 LLDDSCEDYSYDED---DEDDV-------EEEDD--------------------DVEIYSSTISP 269
            |       .::||.   ||:|:       |.|::                    .:|.::|.:: 
  Rat  1040 L-------QNFDESKIVDEEDIFKSFFVFENENNPNLSSNGFESRKDNSSAPMPSLEAFNSVMN- 1096

  Fly   270 ASSGC-----SQQQAVNGERTPGL-----PKHQEQIHHPVSDLMINMRTPMSPAVENGLRQCPLP 324
             |..|     |.|.::.|:.|..:     ...||......|||:::     |...:|        
  Rat  1097 -SEPCVSATKSSQSSLGGKETEQVIILDDSDTQESFVKEDSDLLLS-----STYAKN-------- 1147

  Fly   325 ALAWANAADVWRLMCHRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLA 389
                        :..:..|::.:......:::...|...|||||:||::||...:::..||.|||
  Rat  1148 ------------IFIYLKEREEKFIVTKYMDEQMELTSDMRAILVDWMVEVQANFRMSHETLYLA 1200

  Fly   390 VDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGACTERDILNHEKILL 454
            |..:||||..| :.:|.||||:|.|...:|||.||.|||.:.||.|:.:....:.::::.|:.:|
  Rat  1201 VKLMDRYLMKA-QCEKNHLQLLGSTAYMIAAKFEESYPPSLTEFLYICEDLYPKSEMVSLERNIL 1264

  Fly   455 QALDWDIS-PI 464
            :.|::||: ||
  Rat  1265 KTLNFDINIPI 1275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 44/128 (34%)
Cyclin_C <517..>571 CDD:281044
Ccnb3XP_038956227.1 CYCLIN_SF 1133..1270 CDD:424085 48/162 (30%)
CYCLIN_SF 1274..1388 CDD:424085 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.