DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccna1

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001011949.1 Gene:Ccna1 / 295052 RGDID:1310639 Length:421 Species:Rattus norvegicus


Alignment Length:471 Identity:113/471 - (23%)
Similarity:179/471 - (38%) Gaps:153/471 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ELGFEPPSAKRQQR--LPALYGSEQGNLSSVASSVYTSPVVSVDGQSTQELLSIRS-SPAEDL-S 185
            :||.:||     ||  |..|..:||...:                 ..||:.:||. |.:|:: .
  Rat    29 QLGQDPP-----QRTVLGVLTENEQYRRA-----------------CGQEIATIRCFSGSENVFP 71

  Fly   186 EAPHSPLPDSPDSPPS----------PDRGSKQTPVVVRYAAEQVVTSTVVTQKTEDDDLLDDSC 240
            .|....|||:..|.|:          |::|.:                              |||
  Rat    72 AAGKKVLPDNGVSEPAKHGFDIYMDDPEQGDR------------------------------DSC 106

  Fly   241 ---EDYSYDEDDEDDVEEEDDDVE--IYSSTISP----ASSGCSQQQAVN-GERTPGLPKHQEQI 295
               |...:::..|.|......|:.  :..:|:||    :::....::|.: |.....:.::.|:|
  Rat   107 PGREGIVFEDVYEVDTSMLKSDLHFLLDFNTVSPMLVDSTAHAQSEEATDFGSDVINVTEYAEEI 171

  Fly   296 HHPVSDLMINMRTPMSPAVENGLRQCPLPALAWANAADVWRLMCHRDEQDSRLRSISMLEQHPGL 360
            |..:.:..:.                                  ||.:       ...:.:.|.:
  Rat   172 HRYLREAEVR----------------------------------HRPK-------AHYMRKQPDI 195

  Fly   361 QPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEI 425
            ...|||||:|||:||.|.|||..||.||||::|||:|. ...|.:..|||:|...:.:|:|.|||
  Rat   196 TEGMRAILVDWLVEVGEEYKLRTETLYLAVNFLDRFLS-CMSVLRGKLQLVGTAAILLASKYEEI 259

  Fly   426 YPPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVYM-QLNVNNRTPASFSQI 489
            |||.:.||.|:||...|:|.:|..|.:||:.|.:|::..|...:|..|: :..|..||......:
  Rat   260 YPPDVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCIRTENLAKYV 324

  Fly   490 GRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGMANYSYSVLAAAA-------ISHTFSRE 547
            ......|||.                           ...|..|::||||       ::..|..|
  Rat   325 AELSLLEADP---------------------------FLKYLPSLVAAAAYCLANYIVNRHFWPE 362

  Fly   548 MALRCSGLDWQVIQPC 563
            .....:|.....|.||
  Rat   363 TLAAFTGYSLNEIVPC 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 53/128 (41%)
Cyclin_C <517..>571 CDD:281044 12/54 (22%)
Ccna1NP_001011949.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Cyclin_N2 27..>101 CDD:406812 23/93 (25%)
CYCLIN_CCNA1_rpt1 132..294 CDD:410263 60/203 (30%)
CYCLIN_CCNA1_rpt2 298..420 CDD:410266 21/108 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340028
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.