DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccni

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001099468.1 Gene:Ccni / 289500 RGDID:1309209 Length:377 Species:Rattus norvegicus


Alignment Length:395 Identity:86/395 - (21%)
Similarity:155/395 - (39%) Gaps:70/395 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 AWANAADVWRLMCHRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVD 391
            |.:..|.:|::            ::..:..:..:.|..|..::.||.::...:.|:.|||.||..
  Rat    19 AISREAQMWKV------------NVPKIPTNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASS 71

  Fly   392 YLDRYLHVAHKVQKTHLQLIGITCLFVAAKV--EEIYPPKIGEFAYVTDGACTERDILNHEKILL 454
            .|||:|... |....:|..|.|:|.|:|||.  |:...|.:...|..:...|:..:||..|:|:|
  Rat    72 LLDRFLATV-KAHPKYLNCIAISCFFLAAKTVEEDEKIPVLKVLARDSFCGCSSSEILRMERIIL 135

  Fly   455 QALDWDISPITITGWLGVYMQLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEF--VQTSQL 517
            ..|:||:...|...:|.::..:.|:.|....||               .|:.|..:.  |.|.||
  Rat   136 DKLNWDLHTATPLDFLHIFHAIAVSTRPQLLFS---------------LPRLSPSQHLAVLTKQL 185

  Fly   518 LDLCTLDVGMANYSYSVLAAAAISHTFSREMALRCSGLDW-----QVIQPCARWMEPFFRVISQK 577
            |. |.....:..:..|:||.|.:|....:.:.      ||     :::|................
  Rat   186 LH-CMACNQLLQFKGSMLALAMVSLEMEKLIP------DWLPLTIELLQKAQMDSSQLIHCRELV 243

  Fly   578 APYLQLNEQNEQVSNKFGLGLICPNIVTDDSHIIQTHTTTMDMYDEVLMAQDAAHAMRARIQASP 642
            |.:|...:.:..:::.:....:...:||.|....:.|.:::...|   .::|         .:.|
  Rat   244 AYHLSALQSSLPLNSVYVYRPLKHTLVTCDKGAFKLHPSSISGPD---FSKD---------NSKP 296

  Fly   643 ATALRAPESL-LTPPASS--------HKPDEYLGDEGDETGAR-----SGISSTTTCCNTAASNK 693
            ...:|.|.:. |..||.|        .|.:|...|:..:...|     ||..:..:.|.|..|.:
  Rat   297 EVPVRGPAAFHLHLPAVSGCKHTSAKRKVEEMEVDDLYDGIKRLYNEDSGSENVGSVCGTDLSRQ 361

  Fly   694 GGKSS 698
            .|.:|
  Rat   362 EGHAS 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 36/130 (28%)
Cyclin_C <517..>571 CDD:281044 11/58 (19%)
CcniNP_001099468.1 Cyclin_N 38..142 CDD:278560 34/104 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339994
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.