DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccng1

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_037055.1 Gene:Ccng1 / 25405 RGDID:2295 Length:294 Species:Rattus norvegicus


Alignment Length:284 Identity:65/284 - (22%)
Similarity:109/284 - (38%) Gaps:74/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 EQDSRLR----SISMLEQHPGLQPRMRAILLDW----LIEVCEVYKLHRETFYLAVDYLDRYLHV 399
            ||:||.:    .:.::|.......||.|.|.|:    |:.:.:.:....|||.|||:.|||:|. 
  Rat    21 EQESRCQPKVCGLKLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLS- 84

  Fly   400 AHKVQKTHLQLIGITCLFVAAK--VEEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDIS 462
            ..|||..||..:|::|.::|.|  .||...|...:...::....|..|::..|||:|:.:.|.:.
  Rat    85 KMKVQAKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKIVLEKVCWKVK 149

  Fly   463 PITITGWLGVYMQLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGM 527
            ..|...:|.:|..| :....|                   :.:.:...|.:....|..|...:..
  Rat   150 ATTAFQFLQLYYSL-IRETLP-------------------FERRNDLNFERLEAQLKACHCRIIF 194

  Fly   528 ANYSYSVLAAAAIS--------------------H--------TFSREMALRC------------ 552
            :....||||.|.|:                    |        ||.:|:..:|            
  Rat   195 SKAKPSVLALAIIALEIQALKYVELTEGVECIQKHSKISGRDLTFWQELVSKCLTEYSSNKCSKP 259

  Fly   553 --SGLDWQVIQPCARWME-PFFRV 573
              ..|.|.|....||.:: .::|:
  Rat   260 NGQKLKWIVSGRTARQLKHSYYRI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 40/128 (31%)
Cyclin_C <517..>571 CDD:281044 18/96 (19%)
Ccng1NP_037055.1 CYCLIN_CCNG1 50..147 CDD:410286 31/97 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339997
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.