DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccnd3

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_036898.2 Gene:Ccnd3 / 25193 RGDID:2293 Length:292 Species:Rattus norvegicus


Alignment Length:264 Identity:67/264 - (25%)
Similarity:110/264 - (41%) Gaps:53/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 DSR-LRSISMLEQ------------HPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRY 396
            |.| |:|:..||:            ...::|.||.:|..|::||||..:...:.|.||::|||||
  Rat    24 DQRVLQSLLRLEERYVPRASYFQCVQKEIKPHMRKMLAYWMLEVCEEQRCEEDVFPLAMNYLDRY 88

  Fly   397 LHVAHKVQKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDI 461
            |... ..:|..|||:|..||.:|:|:.|..|..|.:....||.|.....:...|.::|..|.||:
  Rat    89 LSCV-PTRKAQLQLLGTVCLLLASKLRETTPLTIEKLCIYTDQAVAPWQLREWEVLVLGKLKWDL 152

  Fly   462 SPITITGWLGVYMQLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVG 526
            :.:....:|.:.:                .:.|..:|...:..:.:     ||  .|.||..|..
  Rat   153 AAVIAHDFLALIL----------------HRLSLPSDRQALVKKHA-----QT--FLALCATDYT 194

  Fly   527 MANYSYSVLA------------AAAISHTFSREMALRCSGLDWQVIQPCARWME----PFFRVIS 575
            .|.|..|::|            |.::|.....|:....:|.:...::.|...:|    ...|..:
  Rat   195 FAMYPPSMIATGSIGAAVLGLGACSMSADELTELLAGITGTEVDCLRACQEQIEAALRESLREAA 259

  Fly   576 QKAP 579
            |.||
  Rat   260 QTAP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 44/129 (34%)
Cyclin_C <517..>571 CDD:281044 14/69 (20%)
Ccnd3NP_036898.2 CYCLIN_SF 2..151 CDD:424085 42/127 (33%)
CYCLIN_SF 156..260 CDD:424085 20/126 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..292 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340020
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.