DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccnj

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_766427.1 Gene:Ccnj / 240665 MGIID:2443297 Length:379 Species:Mus musculus


Alignment Length:259 Identity:54/259 - (20%)
Similarity:105/259 - (40%) Gaps:56/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 AADVWRLMCHRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDR 395
            |||:.:.:.:::     |:..|...|.|  |..:|....|.:..|...:.|.....:|||..||.
Mouse    13 AADIHQALRYKE-----LKLPSYKGQSP--QLNLRRYFADLIAIVSNRFTLCPPARHLAVYLLDL 70

  Fly   396 YLHVAHKVQKTHLQLIGITCLFVAAKVEEIYP--PKIGEFAYVTDGAC--------TERDILNHE 450
            ::. .:.:....|.|:.::||.:|:|.||...  ||:.:   :....|        |::.:|:.|
Mouse    71 FMD-RYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQ---LNSLGCMTNMNLVLTKQTLLHME 131

  Fly   451 KILLQALDWDISPITITGWLGVYM-----QLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFE 510
            .:||:...|::...|...::..|:     :.::::..|....:..:...|:..|.|         
Mouse   132 LLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMVCLEKTKLYMAKYADYF--------- 187

  Fly   511 FVQTSQLLDLCTLDVGMANYSYSVLAAAAISHTFSREMALRCS-----------GLDWQVIQPC 563
                   |::...|....||:.|::|||.::   |..:.||.|           ...|..:..|
Mouse   188 -------LEVSLQDYAFLNYAPSLVAAACVA---SSRIILRLSPTWPTRLHRLTAYSWDFLVQC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 32/138 (23%)
Cyclin_C <517..>571 CDD:281044 14/58 (24%)
CcnjNP_766427.1 CYCLIN_CCNJ-like_rpt1 34..140 CDD:410231 27/111 (24%)
CYCLIN_CCNJ-like_rpt2 145..245 CDD:410232 20/116 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.