DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and ccna2

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_694481.1 Gene:ccna2 / 192295 ZFINID:ZDB-GENE-020418-1 Length:428 Species:Danio rerio


Alignment Length:354 Identity:92/354 - (25%)
Similarity:157/354 - (44%) Gaps:70/354 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 PASSGCSQQQAVN--GERTPGLPKHQEQIHHPVSDLMINMRTPM-------SPAVEN----GLRQ 320
            |....|..::...  |||.........|||....|...:.:.|:       ||...|    .|||
Zfish    73 PQIIACKPEENARSFGERPSNRQPAAFQIHVDEPDGACSKKAPLQRSTMDCSPLTLNPTVTRLRQ 137

  Fly   321 ------CPLPALAWANAADVWRLMCHRDEQDSRLRSIS----------------------MLEQH 357
                  .||.| ::.:..|:..:.|  :|:.:.:..:|                      .:.:.
Zfish   138 PLATIDLPLEA-SFDSPMDMSVIDC--EERPTNVNEVSDYAAEIHTHLREMEVKSKPKAGYMRKQ 199

  Fly   358 PGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKV 422
            |.:...|||||:|||:||.|.|||..||.||||:|:||:|. :..|.:..|||:|...:.:|:|.
Zfish   200 PDITNSMRAILVDWLVEVGEEYKLQNETLYLAVNYIDRFLS-SMSVLRGKLQLVGTAAMLLASKF 263

  Fly   423 EEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVY-MQLNVNNRTPASF 486
            ||||||::.||.|:||...|::.:|..|.::|..|.:|::..||..:|..| :...|:::..:..
Zfish   264 EEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLTVLSFDLAAPTINQFLTQYFLHQPVSSKVESLS 328

  Fly   487 SQIGRQKSAEADDAFIY--PQFSGFEFVQTSQLLDLCTLDVGMANYSYSVLAAAAISHTFSREMA 549
            ..:|.....:.|....|  .|.:...|:              :||::.:       |.::|:.: 
Zfish   329 MFLGELSLIDCDPFLKYLPSQMAAAAFI--------------LANHTLA-------SGSWSKSL- 371

  Fly   550 LRCSGLDWQVIQPCARWMEPFFRVISQKA 578
            :..:|...:.:.||.:.:...:...||.|
Zfish   372 VDLTGYSLEDLLPCVQDLHQTYLAASQHA 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 53/150 (35%)
Cyclin_C <517..>571 CDD:281044 7/53 (13%)
ccna2NP_694481.1 Cyclin_N2 33..157 CDD:293109 20/84 (24%)
Cyclin_N 177..303 CDD:278560 49/126 (39%)
Cyclin_C 305..422 CDD:281044 20/118 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579846
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.