DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and F08F1.9

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_509425.1 Gene:F08F1.9 / 184192 WormBaseID:WBGene00017259 Length:130 Species:Caenorhabditis elegans


Alignment Length:105 Identity:33/105 - (31%)
Similarity:47/105 - (44%) Gaps:23/105 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 MRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIYPP 428
            ||.||:||..:....|....|..:|||..:||.|.: ..:.|...||:|||.:.:|.|.|||:||
 Worm     1 MRTILIDWFSDAVREYIFRNEAVHLAVSLVDRALPM-FNINKMRFQLVGITSMRIAVKYEEIFPP 64

  Fly   429 KIGEFAYVTDGA----------------------CTERDI 446
            .:....:..|||                      |||.::
 Worm    65 ILSNTRHSFDGAILYWKVRLHRRNAHTILDRIMLCTENEL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 33/105 (31%)
Cyclin_C <517..>571 CDD:281044
F08F1.9NP_509425.1 Cyclin_N <1..>68 CDD:365896 27/67 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.