DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and cyb-1

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_501987.1 Gene:cyb-1 / 177965 WormBaseID:WBGene00000865 Length:361 Species:Caenorhabditis elegans


Alignment Length:378 Identity:99/378 - (26%)
Similarity:165/378 - (43%) Gaps:87/378 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 QAVNGERTPG--------LPKHQEQIHHPVSDLMINMR---------TPMSPA-VEN-------G 317
            :|.|..||..        :.||......||:...:..:         .|.:|| ||.       .
 Worm     3 RATNNRRTSNNVEKDSLQMAKHGNGPLKPVNAQGLQTKREAREILALKPSNPAPVETAQKSQRIN 67

  Fly   318 LRQCPLPALAWANAADVWRLMCHRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLH 382
            |:......||.|:  |:::.:.|. |:...|....|....|  .|:||.||:|||::|...:.|.
 Worm    68 LQDAETKCLAMAD--DIYKYLVHH-EKKYLLEECFMEGGEP--TPKMRRILVDWLVQVHVRFHLT 127

  Fly   383 RETFYLAVDYLDRYLHVAHKV-QKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGACTERDI 446
            .||.:|.|..|||.|.  .|| .|..|||:||:.:|||:|.||:|.|.|.::.::|:...:::.|
 Worm   128 PETLHLTVFILDRMLQ--KKVTSKADLQLLGISAMFVASKFEEVYLPDIHDYEFITENTYSKKQI 190

  Fly   447 LNHEKILLQALDWDIS-PITITGWLGVYMQ-----LNVNNRTPASFSQIGRQKSAEADDAFIYPQ 505
            |..|:.:|.:|::|:| |.::     |:::     |:.|:.:|..            :.||.|. 
 Worm   191 LAMEQTILNSLNFDLSCPSSL-----VFLRCLSRILSENDASPID------------NQAFCYT- 237

  Fly   506 FSGFEFVQTSQLL-DLCTLDVGMANYSYSVLAAAAISHTFSREM--ALRCSGLDW----QVIQPC 563
                  ...|:.| :|..||        ||:|:...||..|..|  ||....:|.    ..:...
 Worm   238 ------YNISKCLGELALLD--------SVMASTPRSHIASASMIIALEVHPVDGIEAENAVSVI 288

  Fly   564 ARWMEPFFRVISQKAPYL-QLNEQNEQ------VSNKFGLGLIC--PNIVTDD 607
            .:.:....:||......| :::.:|.:      :.||:....:.  .|::|||
 Worm   289 CKQLGASKKVIEDAVALLAEVSYKNFKQGKLVAIKNKYQSSKLAQVSNLMTDD 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 48/129 (37%)
Cyclin_C <517..>571 CDD:281044 14/60 (23%)
cyb-1NP_501987.1 Cyclin_N 81..206 CDD:278560 48/129 (37%)
Cyclin_C 208..337 CDD:281044 29/160 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.