DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and ccng1

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_021336635.1 Gene:ccng1 / 171473 ZFINID:ZDB-GENE-020322-1 Length:313 Species:Danio rerio


Alignment Length:197 Identity:54/197 - (27%)
Similarity:91/197 - (46%) Gaps:20/197 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 EQDSR----LRSISMLE--QHPGLQPRMRAILLDWLIEVCEVYKLHR------ETFYLAVDYLDR 395
            :|:||    |..:.::|  |..||  ||...|.|:  :|.|:..|.|      |||..||:.|||
Zfish    36 DQESRYQPKLCGLRVIESAQDNGL--RMTVKLRDY--QVRELLSLTRFFGFCAETFSFAVNLLDR 96

  Fly   396 YLHVAHKVQKTHLQLIGITCLFVAAKV--EEIYPPKIGEFAYVTDGACTERDILNHEKILLQALD 458
            :|.|. |:|..||..:|:.|.::|.|.  ||...|...:...::....|..|::..|||:|:.|:
Zfish    97 FLAVM-KIQPKHLSCVGLCCFYIAVKTSEEEKNVPLASDLIRISQNRFTVHDMMRMEKIILEKLN 160

  Fly   459 WDISPITITGWLGVYMQLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTL 523
            |.:...|...:|. :...::..:......:|...:..||.....:..|:..:...:...|.|..|
Zfish   161 WKV
KAPTALHFLR-FFHSHIQEKVDTESKKILNIERLEAQLKACHCSFTFTKLKPSLLALSLLAL 224

  Fly   524 DV 525
            ::
Zfish   225 EI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 45/132 (34%)
Cyclin_C <517..>571 CDD:281044 3/9 (33%)
ccng1XP_021336635.1 Cyclin_N 31..163 CDD:306612 45/131 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579805
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.