DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccni

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_059063.2 Gene:Ccni / 12453 MGIID:1341077 Length:377 Species:Mus musculus


Alignment Length:413 Identity:94/413 - (22%)
Similarity:156/413 - (37%) Gaps:106/413 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 AWANAADVWRLMCHRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVD 391
            |.:..|.:|::            ::..:..:..:.|..|..::.||.::...:.|:.|||.||..
Mouse    19 AISREAQMWKV------------NVPKIPTNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASS 71

  Fly   392 YLDRYLHVAHKVQKTHLQLIGITCLFVAAKV--EEIYPPKIGEFAYVTDGACTERDILNHEKILL 454
            .|||:|... |....:|..|.|:|.|:|||.  |:...|.:...|..:...|:..:||..|:|:|
Mouse    72 LLDRFLATV-KAHPKYLNCIAISCFFLAAKTVEEDEKIPVLKVLARDSFCGCSSSEILRMERIIL 135

  Fly   455 QALDWDISPITITGWLGVYMQLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEF--VQTSQL 517
            ..|:||:...|...:|.::..:.|:.|....||               .|:.|..:.  |.|.||
Mouse   136 DKLNWDLHTATPLDFLHIFHAIAVSARPQLLFS---------------LPKLSPSQHLAVLTKQL 185

  Fly   518 LDLCTLDVGMANYSYSVLAAAAISHTFSREMALRCSGLDWQVIQPCARWMEPFFRVISQKAPY-- 580
            |. |.....:..:..|:||.|.:|             |:.:.:.|  .|: |....:.|||..  
Mouse   186 LH-CMACNQLLQFKGSMLALAMVS-------------LEMEKLIP--DWL-PLTIELLQKAQMDS 233

  Fly   581 LQLNEQNEQVS-NKFGLGLICP------------NIVTDDSHIIQTHTTTMDMYDEVLMAQDAAH 632
            .||....|.|: :...|....|            .:||.|....:.|.:::...|   .::|   
Mouse   234 SQLIHCRELVAYHLSALQSALPLNSVYVYRPLKHTLVTCDKGAFKLHPSSVSGPD---FSKD--- 292

  Fly   633 AMRARIQASPATALRAPESL-LTPPASS--------HKPDE-------------YLGDEGDETGA 675
                  .:.|...:|.|.:. |..||:|        .|.:|             |..|.|.|   
Mouse   293 ------NSKPEVPVRGPAAFHLHLPAASGCKQTSAKRKVEEMEVDDFYDGIKRLYNEDNGPE--- 348

  Fly   676 RSGISSTTTCCNTAASNKGGKSS 698
                 :..:.|.|..|.:.|.:|
Mouse   349 -----NVGSVCGTDLSRQEGHAS 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 36/130 (28%)
Cyclin_C <517..>571 CDD:281044 12/53 (23%)
CcniNP_059063.2 Cyclin_N 39..142 CDD:365896 34/103 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..377 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836327
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.