DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccng2

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_031661.3 Gene:Ccng2 / 12452 MGIID:1095734 Length:344 Species:Mus musculus


Alignment Length:158 Identity:45/158 - (28%)
Similarity:76/158 - (48%) Gaps:11/158 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 LAWANAADVWRLMCHRDEQDSRL----RSISMLEQHP----GLQPRMRAILLDWLIEVCEVYKLH 382
            ||......::.|:....||:.|.    :.:.::|..|    .|..|:|...::.|..:...:...
Mouse     9 LAGGEGVQLFGLLNFYLEQEQRYQPREKGLILMEATPENDNTLCSRLRNAKVEDLRSLTNFFGSG 73

  Fly   383 RETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKV--EEIYPPKIGEFAYVTDGACTERD 445
            .|||.|||:.|||:|.:. ||:..||..||:.|..:||::  ||...|...:...::...||..|
Mouse    74 TETFVLAVNILDRFLALM-KVKPKHLSCIGVCCFLLAARLAEEEGDVPPTHDVIRISQCKCTASD 137

  Fly   446 ILNHEKILLQALDWDISPITITGWLGVY 473
            |...|||:.:.|.:::...|...:|.:|
Mouse   138 IKRMEKIISEKLHYELEATTALNFLHLY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 40/138 (29%)
Cyclin_C <517..>571 CDD:281044
Ccng2NP_031661.3 Cyclin_N <74..153 CDD:278560 30/79 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836346
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.