DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccne2

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001032211.1 Gene:Ccne2 / 12448 MGIID:1329034 Length:404 Species:Mus musculus


Alignment Length:404 Identity:145/404 - (35%)
Similarity:205/404 - (50%) Gaps:83/404 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 KHQEQIHHPVSDLMINMRTPMSPAVENGLRQC-------------------------------PL 323
            |||.:|           |....|.:..|:..|                               ||
Mouse    49 KHQYEI-----------RNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPL 102

  Fly   324 PALAWANAADVWRLMCHRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYL 388
            |.|:||.:.:||:.|..::.:....:...:|  |..|:|:||:||||||:||||||.||||||||
Mouse   103 PDLSWACSQEVWQNMLQKENRYVHDKHFQVL--HSDLEPQMRSILLDWLLEVCEVYTLHRETFYL 165

  Fly   389 AVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGACTERDILNHEKIL 453
            |.|:.||::.....|.|..|||||||.||:|:|:||||.||:.||||||||||:|.|||..|..:
Mouse   166 AQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVDILKMELNI 230

  Fly   454 LQALDWDISPITITGWLGVYMQLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLL 518
            |:||.|::.|:|:..||.:::|::.....|                ..:.||:|...|:|.:|||
Mouse   231 LKALKWELCPVTVISWLNLFLQVDAVKDVP----------------KVLLPQYSQETFIQIAQLL 279

  Fly   519 DLCTLDVGMANYSYSVLAAAAISHTFSREMALRCSGLDWQVIQPCARWMEPFFRVISQKAPYLQL 583
            |||.|.:....:.|.:|||||:.|..|.|:..:.|||:|..|..|..||.||..|:...:| ::|
Mouse   280 DLCILAIDSLEFQYRILAAAALCHFTSIEVVKKASGLEWDDISECVDWMVPFVSVVKSVSP-VKL 343

  Fly   584 NEQNEQVSNKFGLGLICPNIVTDDSHIIQTHTTTMDMYDEVLMAQDAAHAMRARIQASPATALRA 648
            ....:              |..:|.|.|||||..:.:.:||    :..:..|...|.||.    .
Mouse   344 KTFKK--------------IPMEDRHNIQTHTNYLALLNEV----NYVNIYRKGGQLSPV----C 386

  Fly   649 PESLLTPPASSHKP 662
            ...::|||.|:.||
Mouse   387 NGGIMTPPKSTEKP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 71/128 (55%)
Cyclin_C <517..>571 CDD:281044 24/53 (45%)
Ccne2NP_001032211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
Cyclin_N 112..239 CDD:365896 71/128 (55%)
Cyclin_C 241..361 CDD:367282 45/150 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836318
Domainoid 1 1.000 160 1.000 Domainoid score I4041
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 274 1.000 Inparanoid score I2952
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0002994
OrthoInspector 1 1.000 - - otm43236
orthoMCL 1 0.900 - - OOG6_105145
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2444
SonicParanoid 1 1.000 - - X2342
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.