DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccnd2

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_036021678.1 Gene:Ccnd2 / 12444 MGIID:88314 Length:349 Species:Mus musculus


Alignment Length:291 Identity:71/291 - (24%)
Similarity:118/291 - (40%) Gaps:74/291 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 HQEQIHHPVSDLMINMRTPMSPAVENGLRQCPLPALAWANAADVW-----------------RLM 338
            |:|:...|.|      .|.||....:|:|....|  .|:.....|                 .|.
Mouse     9 HREEAMTPSS------WTEMSLLRGDGIRTSSTP--GWSVLRVTWLAGIRQSGPSGGRLAMELLC 65

  Fly   339 CHRDE-----------QDSRLRSISMLEQ------------HPGLQPRMRAILLDWLIEVCEVYK 380
            |..|.           :|..|:::..:|:            ...:||.||.::..|::||||..|
Mouse    66 CEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQK 130

  Fly   381 LHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGACTERD 445
            ...|.|.||::||||:| ......||||||:|..|:|:|:|::|..|....:....||.:...::
Mouse   131 CEEEVFPLAMNYLDRFL-AGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSVKPQE 194

  Fly   446 ILNHEKILLQALDWDISPITITGWLGVYMQLNVNNRTPASF-SQIGRQKSAEADDAFIYPQFSGF 509
            :|..|.::|..|.|:::.:                 ||..| ..|.|:...:.:...:..:.:  
Mouse   195 LLEWELVVLGKLKWNLAAV-----------------TPHDFIEHILRKLPQQKEKLSLIRKHA-- 240

  Fly   510 EFVQTSQLLDLCTLDVGMANYSYSVLAAAAI 540
               ||  .:.||..|...|.|..|::|..::
Mouse   241 ---QT--FIALCATDFKFAMYPPSMIATGSV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 46/168 (27%)
Cyclin_C <517..>571 CDD:281044 7/24 (29%)
Ccnd2XP_036021678.1 CYCLIN_CCND2_rpt1 61..209 CDD:410277 44/148 (30%)
CYCLIN_CCND2_rpt2 214..318 CDD:410280 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.