DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccnd1

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001366177.1 Gene:Ccnd1 / 12443 MGIID:88313 Length:317 Species:Mus musculus


Alignment Length:349 Identity:81/349 - (23%)
Similarity:132/349 - (37%) Gaps:118/349 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 PRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIY 426
            |.||.|:..|::||||..|...|.|.||::||||:|.: ..::|:.|||:|.||:|||:|::|..
Mouse    54 PSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSL-EPLKKSRLQLLGATCMFVASKMKETI 117

  Fly   427 PPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVYMQLNVNNRTPASFSQIGR 491
            |....:....||.:....::|..|.:|:..|.|:::.:                 ||..|.:...
Mouse   118 PLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAM-----------------TPHDFIEHFL 165

  Fly   492 QKSAEADDAFIYPQFSGFEFVQT-----SQLLDLCTLDVGMANYSYSVLAAAAI----------- 540
            .|..|||           |..||     ...:.||..||...:...|::||.::           
Mouse   166 SKMPEAD-----------ENKQTIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGS 219

  Fly   541 ----------SHTFSREMALRCSGLDWQVIQPCARWMEPFFRVISQKAPYLQLNEQNEQVSNKFG 595
                      :|..||  .::|               :|    :...|..|.||:          
Mouse   220 PNNFLSCYRTTHFLSR--VIKC---------------DP----VKALATGLWLNK---------- 253

  Fly   596 LGLICPNIVTDDSHIIQTHTTTMDMYDEVLMAQDAAHAMRARIQASPATALRAPESLLTPPASSH 660
                      |..|:...             .||...|.:.:|:|...::||..:..:.|.|:  
Mouse   254 ----------DPLHLRPP-------------LQDCLRACQEQIEALLESSLRQAQQNVDPKAT-- 293

  Fly   661 KPDEYLGDEGDETGARSGISSTTT 684
                   :|..|....:|::.|.|
Mouse   294 -------EEEGEVEEEAGLACTPT 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 39/99 (39%)
Cyclin_C <517..>571 CDD:281044 12/74 (16%)
Ccnd1NP_001366177.1 CYCLIN_CCND1_rpt1 3..151 CDD:410276 38/97 (39%)
CYCLIN_CCND1_rpt2 156..287 CDD:410279 35/195 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.