DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccna1

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001292150.1 Gene:Ccna1 / 12427 MGIID:108042 Length:421 Species:Mus musculus


Alignment Length:235 Identity:75/235 - (31%)
Similarity:110/235 - (46%) Gaps:39/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 HRDEQDSRLR---SISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAH 401
            ||..:::.:|   ....:.:.|.:...|||||:|||:||.|.|||..||.||||::|||:|. ..
Mouse   172 HRYLREAEVRHRPKAHYMRKQPDITEGMRAILVDWLVEVGEEYKLRTETLYLAVNFLDRFLS-CM 235

  Fly   402 KVQKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPITI 466
            .|.:..|||:|...:.:|:|.||||||.:.||.|:||...|:|.:|..|.:||:.|.:|::..|.
Mouse   236 SVLRGKLQLVGTAAILLASKYEEIYPPDVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTT 300

  Fly   467 TGWLGVYM-QLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGMANY 530
            ..:|..|: :..|..||......:......|||.                           ...|
Mouse   301 NQFLLQYLRRQGVCIRTENLAKYVAELSLLEADP---------------------------FLKY 338

  Fly   531 SYSVLAAAA-------ISHTFSREMALRCSGLDWQVIQPC 563
            ..|::||||       ::..|..|.....:|.....|.||
Mouse   339 LPSLVAAAAYCLANYIVNRHFWPETLAAFTGYSLNEIVPC 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 54/124 (44%)
Cyclin_C <517..>571 CDD:281044 12/54 (22%)
Ccna1NP_001292150.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Cyclin_N2 27..>101 CDD:406812
CYCLIN_CCNA1_rpt1 132..294 CDD:410263 53/122 (43%)
CYCLIN_CCNA1_rpt2 298..420 CDD:410266 21/108 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836360
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.