DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and Ccnf

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_038941012.1 Gene:Ccnf / 117524 RGDID:67401 Length:818 Species:Rattus norvegicus


Alignment Length:479 Identity:98/479 - (20%)
Similarity:157/479 - (32%) Gaps:163/479 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 MCHRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHK 402
            :|...:....:....:.....||...||.||:|||:||..:........:|.|:.:||||. ...
  Rat   321 VCQLFQASQAVNKQQIFSVQKGLSDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDRYLR-RRL 384

  Fly   403 VQKTHLQLIGITCLFVAAKV--EEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPIT 465
            |.:..|||:||.|:.:..:.  :||.  .|.|..::||......|::.....::.||:..|...|
  Rat   385 VPRYKLQLLGIACMVICTRFISKEIL--TIREAVWLTDNTYKYEDLVRVMGEIISALEGKIRIPT 447

  Fly   466 ITGWLGVYMQL-NVNNRTP--ASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGM 527
            :..:..|.:.| .|..||.  .||                              |.:|..|...:
  Rat   448 VVDYKEVLLTLVPVAPRTQHLCSF------------------------------LCELTLLHTSL 482

  Fly   528 ANYSYSVLAAAAI-------SHTFSREMAL-RCSGLDWQVIQPCARWMEPFFRVISQKAP--YLQ 582
            :.|:.:.||:||:       .||......| ..:|..:..:.||...:..  :.....||  |.|
  Rat   483 SVYAPARLASAALLLARLMHGHTQPWTTQLWDLTGFSYSDLTPCVLSLHK--KCFHDDAPKDYRQ 545

  Fly   583 --LNEQNEQVSNKFGLGLICPNIVTDDSHIIQTHTTTMDMYDEVLMAQDAAHAMRARIQASPA-- 643
              |....::..:|      |...::.               :|||...:...|:..: |.||.  
  Rat   546 VSLTAVKQRFEDK------CYEEISQ---------------EEVLSYAELCSALGVK-QESPEPP 588

  Fly   644 ---------TALRAPES------------------LLTPPASSHKPDE----------------Y 665
                     |.|.:|..                  :.||.|.....:|                |
  Rat   589 SFPSSGEIHTFLSSPSGRRSKRKRENSLQEDRGSFVTTPTAELSNQEETLLGSLLDWSLDCCSGY 653

  Fly   666 LGD---EGDETG---ARSGISSTTT--------CCNTAAS------------------------- 691
            .||   ||::.|   |.||:...|.        ||..::.                         
  Rat   654 EGDQESEGEKEGDVTAPSGLLDVTVVYLNPEEHCCQESSDEEVWPEDKSHPTPGTQAPPASAPWP 718

  Fly   692 ---NKG--GKSSSNNSVTSCSSRS 710
               |:|  ||..:.:..:|.||.|
  Rat   719 LPCNRGDPGKDVTTSGYSSVSSSS 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 34/125 (27%)
Cyclin_C <517..>571 CDD:281044 14/61 (23%)
CcnfXP_038941012.1 FBOX 73..111 CDD:197608
CYCLIN_CCNF_rpt1 345..439 CDD:410225 29/96 (30%)
CYCLIN_CCNF_rpt2 467..578 CDD:410226 26/163 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340023
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.