DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and CCNI

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001335061.1 Gene:CCNI / 10983 HGNCID:1595 Length:377 Species:Homo sapiens


Alignment Length:388 Identity:84/388 - (21%)
Similarity:150/388 - (38%) Gaps:66/388 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 ADVWRLMCHRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRY 396
            |.:|::            ::..:..:..:.|..|..::.||.::...:.|:.|||.||...|||:
Human    24 AQMWKV------------NVRKMPSNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASSLLDRF 76

  Fly   397 LHVAHKVQKTHLQLIGITCLFVAAKV--EEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDW 459
            |... |....:|..|.|:|.|:|||.  |:...|.:...|..:...|:..:||..|:|:|..|:|
Human    77 LATV-KAHPKYLSCIAISCFFLAAKTVEEDERIPVLKVLARDSFCGCSSSEILRMERIILDKLNW 140

  Fly   460 DISPITITGWLGVYMQLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEF--VQTSQLLDLCT 522
            |:...|...:|.::..:.|:.|....||               .|:.|..:.  |.|.|||. |.
Human   141 DLHTATPLDFLHIFHAIAVSTRPQLLFS---------------LPKLSPSQHLAVLTKQLLH-CM 189

  Fly   523 LDVGMANYSYSVLAAAAISHTFSREMALRCSGLDW-----QVIQPCARWMEPFFRVISQKAPYLQ 582
            ....:..:..|:||.|.:|....:.:.      ||     :::|................|.:|.
Human   190 ACNQLLQFRGSMLALAMVSLEMEKLIP------DWLSLTIELLQKAQMDSSQLIHCRELVAHHLS 248

  Fly   583 LNEQNEQVSNKFGLGLICPNIVTDDSHIIQTHTTTMDMYD--------EVLMAQDAA--HAMRAR 637
            ..:.:..:::.:....:...:||.|..:.:.|.:::...|        ||.:...||  |.:.|.
Human   249 TLQSSLPLNSVYVYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAA 313

  Fly   638 IQASPATALRAPESLLTPPASSHKPDEYLGDEG--DETGARSGISSTTTCCNTAASNKGGKSS 698
            ......:..|..|.:       ...|.|.|.:.  :|......:.|.   |.|..|.:.|.:|
Human   314 SGCKQTSTKRKVEEM-------EVDDFYDGIKRLYNEDNVSENVGSV---CGTDLSRQEGHAS 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 36/130 (28%)
Cyclin_C <517..>571 CDD:281044 11/58 (19%)
CCNINP_001335061.1 Cyclin_N 34..142 CDD:365896 34/108 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..377 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146228
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.