DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and LOC105948063

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_012824177.1 Gene:LOC105948063 / 105948063 -ID:- Length:301 Species:Xenopus tropicalis


Alignment Length:149 Identity:39/149 - (26%)
Similarity:70/149 - (46%) Gaps:15/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 ISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITC 415
            ::.|::.|.:.....:.:...:|.|...|....||..|:::.|.|:|... .::..:|:.:|.||
 Frog    84 VNFLDKQPNISETSWSAVTTQMINVHRKYGFDFETLCLSINMLQRFLDCT-PIEIANLKAVGATC 147

  Fly   416 LFVAAKVEEIYPPKIGEF--AYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVYMQLNV 478
            |:||.||.|.:.|:...|  |:...| .|...:...||::||.|.:.:...||..:|..|     
 Frog   148 LYVACKVVEKHQPEKQNFLNAFTNTG-LTPTLLYGLEKLILQQLQYRLWAPTINSFLEYY----- 206

  Fly   479 NNRTPASFSQIGRQKSAEA 497
                  |..::.|.|::.|
 Frog   207 ------SLQRMSRNKNSHA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 31/112 (28%)
Cyclin_C <517..>571 CDD:281044
LOC105948063XP_012824177.1 Cyclin_N 71..194 CDD:365896 31/111 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.