DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and ccno

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001373739.1 Gene:ccno / 101883490 -ID:- Length:300 Species:Danio rerio


Alignment Length:246 Identity:56/246 - (22%)
Similarity:108/246 - (43%) Gaps:39/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 PLPALAWANAADVWRLMCHR----------DEQDS-------RLR-----SISMLEQHPGLQPRM 364
            |.|:...:::.....|:|..          |.:||       ||.     :::.|.:.|.:....
Zfish     4 PSPSSTLSDSGFEDELLCSPVRCASDSQVCDYEDSETCFIIQRLNQQQFLALNCLSRQPQITAEA 68

  Fly   365 RAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIYPPK 429
            |:.|:.|||.|.....|..|:..|||:.:||:| :...|.....||:|:|.|.:|.|..|:|.|:
Zfish    69 RSKLVSWLIAVRRQLSLSFESCCLAVNIMDRFL-ITTSVAADCFQLLGVTSLLIATKQVEVYSPR 132

  Fly   430 IGEFAYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVYMQLNVNNRTPASFSQIGRQKS 494
            |.:...:...:.:...:.|.|.::|..|::.::..|:..:|..:......::|....|       
Zfish   133 ITQLLSLCCNSFSREQLCNLECLILLRLNFRLAAPTLAFFLDYFTSRFTGHQTGEFIS------- 190

  Fly   495 AEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGMANYSY-----SVLAAAAI 540
              |.:|.::.:.|..|.........:|  ::.:|:|::     ||:|..|:
Zfish   191 --AQNAHLHKEPSSAENKWRWLACKVC--ELSLADYTFNKYMPSVIAQCAL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 39/150 (26%)
Cyclin_C <517..>571 CDD:281044 7/29 (24%)
ccnoNP_001373739.1 CYCLIN_SF 68..160 CDD:424085 29/92 (32%)
CYCLIN_SF 167..291 CDD:424085 15/82 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.