DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and LOC100364016

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_008756873.2 Gene:LOC100364016 / 100364016 RGDID:2321841 Length:366 Species:Rattus norvegicus


Alignment Length:300 Identity:79/300 - (26%)
Similarity:131/300 - (43%) Gaps:89/300 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 QAVNGERTPGLPKHQEQIHHPVSDLM-INMRTPMSPAVENGLRQCPLPA------------LAWA 329
            :|:|..:.|          .|.:.:. :.|.| ::|       :.||||            .|::
  Rat    64 KAINASKQP----------KPTASVKPVQMET-LAP-------KDPLPAPEDVSMKEESLCQAFS 110

  Fly   330 NAADVWRLMCHRDEQDSR------------------LRSISMLEQ-HP------GLQPRMRAILL 369
            :|     |:|..::.|:.                  ||.:..|:. :|      .:..||||||:
  Rat   111 DA-----LLCKIEDIDNEDGENPQLCSDYVKDIYQYLRQLEALQSINPHFLDGRDINGRMRAILV 170

  Fly   370 DWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIYPPKIGEFA 434
            |||::|...::|.:||.|:.:..:||:|. |..|.:..|||:|||.|.:|:|.||::.|.|.:|.
  Rat   171 DWLVQVHSKFRLLQETLYMCIAIMDRFLQ-AQPVCRKKLQLVGITALLLASKYEEMFSPNIEDFV 234

  Fly   435 YVTDGACTERDILNHEKILLQALDWDISPITITGWLGVYMQLNVNNRTPASFSQIGRQKSAEADD 499
            |:||.|.|...|...|.::|:.|.::         ||..:.|:...|.         .|:.|.|.
  Rat   235 YITDNAYTSSQIREMETLILKELKFE---------LGRPLPLHFLRRA---------SKAGEVDV 281

  Fly   500 AFIYPQFSGFEFVQTSQLLDLCTLDVGMANYSYSVLAAAA 539
            .         :......|::|..:|..|.:|..|.:||||
  Rat   282 E---------QHTLAKYLMELTLVDYDMVHYHPSQVAAAA 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 49/153 (32%)
Cyclin_C <517..>571 CDD:281044 9/22 (41%)
LOC100364016XP_008756873.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.