Sequence 1: | NP_001246037.1 | Gene: | CycE / 34924 | FlyBaseID: | FBgn0010382 | Length: | 712 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003200952.1 | Gene: | ccni2 / 100330479 | ZFINID: | ZDB-GENE-081106-2 | Length: | 310 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 46/201 - (22%) |
---|---|---|---|
Similarity: | 81/201 - (40%) | Gaps: | 57/201 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 284 RTPGLPKHQEQIHHPVSDLMIN-----MRTPMSPAVENGLRQCPLPALAWANAADVWRLMCHRDE 343
Fly 344 QDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHL 408
Fly 409 QLIGITCLFVAAKVEEIYPPKIGEFAYVTD----GAC--TERDILNHEKILLQALDWDISPITIT 467
Fly 468 GWLGVY 473 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CycE | NP_001246037.1 | Cyclin_N | 333..462 | CDD:278560 | 34/134 (25%) |
Cyclin_C | <517..>571 | CDD:281044 | |||
ccni2 | XP_003200952.1 | Cyclin_N | 36..144 | CDD:278560 | 35/148 (24%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170579832 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5024 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |