DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and ccni2

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_003200952.1 Gene:ccni2 / 100330479 ZFINID:ZDB-GENE-081106-2 Length:310 Species:Danio rerio


Alignment Length:201 Identity:46/201 - (22%)
Similarity:81/201 - (40%) Gaps:57/201 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 RTPGLPKHQEQIHHPVSDLMIN-----MRTPMSPAVENGLRQCPLPALAWANAADVWRLMCHRDE 343
            :.||     |:.:..:..|::|     ||...:|.::||..|          .:|          
Zfish     2 KLPG-----EEENQRLGTLLLNTLDREMRLWRAPVLKNGCIQ----------GSD---------- 41

  Fly   344 QDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHL 408
                   ||..:.|        .::| ||.|:..:::...||..|.|..|:..|... |.|..:|
Zfish    42 -------ISPSQYH--------EVIL-WLREMNVIFQFSTETLALGVCVLNSLLATV-KTQLKYL 89

  Fly   409 QLIGITCLFVAAKVEEIYPPKIGEFAYVTD----GAC--TERDILNHEKILLQALDWDISPITIT 467
            :.:.||.|.:|||:.|    :....|.|.|    ..|  :..:||..|:::|..|.|::...|..
Zfish    90 KCMAITSLILAAKINE----EDEVIASVKDLLEQSRCKFSTAEILRMERVILHKLHWELYLATPM 150

  Fly   468 GWLGVY 473
            .::.::
Zfish   151 DFIHIF 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 34/134 (25%)
Cyclin_C <517..>571 CDD:281044
ccni2XP_003200952.1 Cyclin_N 36..144 CDD:278560 35/148 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579832
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.