DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and ripply2

DIOPT Version :10

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_002938499.1 Gene:ripply2 / 100151713 XenbaseID:XB-GENE-956338 Length:124 Species:Xenopus tropicalis


Alignment Length:42 Identity:8/42 - (19%)
Similarity:15/42 - (35%) Gaps:16/42 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CEDYSYDEDD----------------EDDVEEEDDDVEIYSS 265
            |.|:.|.|.:                |.|.:.:.:..|:|.:
 Frog    83 CYDFMYQEAEQLLRHFPVQATISLYQETDSDSDSEGEEMYDN 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 CYCLIN_CCNE_rpt1 327..459 CDD:410223
CYCLIN_CCNE_rpt2 463..576 CDD:410224
ripply2XP_002938499.1 Ripply 29..117 CDD:464433 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.