DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and ccni2

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001096463.1 Gene:ccni2 / 100125081 XenbaseID:XB-GENE-5874358 Length:358 Species:Xenopus tropicalis


Alignment Length:352 Identity:80/352 - (22%)
Similarity:127/352 - (36%) Gaps:129/352 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 RTPGLPKHQEQIHHPVSDLMINMRTPMS--------PAVENGLRQCPLPALAWANAADVWRLMCH 340
            :.|||...|.        |||::...:.        ||.|.|.          ....|:      
 Frog     2 KCPGLSDFQR--------LMISLENSLQLEDTKWKVPAFEGGT----------LKGTDI------ 42

  Fly   341 RDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQK 405
                     |::..||         |||  |:.||...::.:.|||.|||..|:|.| .:.|||.
 Frog    43 ---------SLTHYEQ---------AIL--WIDEVTLRFRFYPETFGLAVSILNRIL-ASVKVQV 86

  Fly   406 THLQLIGITCLFVAAKV--EEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPITITG 468
            .:|:.|.:||||:|||.  |:...|.:...|..:...|:..:||..|:|:|..|.||:...|...
 Frog    87 KYLRCITVTCLFLAAKTNEEDEIIPSVKRLAVQSGCMCSPAEILRMERIVLDKLQWDLCTATPVD 151

  Fly   469 WLGVYMQLNVNN----------RTPAS-FSQIGRQ------------------------------ 492
            :|..:..:.::|          ..|:| .:.:.||                              
 Frog   152 FLNTFHAMLMSNLPHLFHDCLRMNPSSHLALLTRQLQQCMACHQLVQFRGSTLALVIITLELEKL 216

  Fly   493 ------------KSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGM---ANYSYSVLAAAAISH 542
                        |.|:.|.|         :|:...:|:|   ..:||   :|:.|..:.|.....
 Frog   217 TADWFPAITELLKKAKVDSA---------KFILCKELVD---QHLGMLSPSNHVYVFIPAKRNPQ 269

  Fly   543 TFSREMALRCSGLDWQVIQPCARWMEP 569
            .:.::.:..||.      ||.:|.|.|
 Frog   270 AYHKQKSSACSP------QPISRNMNP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 43/130 (33%)
Cyclin_C <517..>571 CDD:281044 14/56 (25%)
ccni2NP_001096463.1 Cyclin_N 44..145 CDD:278560 41/112 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.