DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and ccnjl

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001296774.1 Gene:ccnjl / 100001904 ZFINID:ZDB-GENE-030131-9888 Length:407 Species:Danio rerio


Alignment Length:368 Identity:73/368 - (19%)
Similarity:131/368 - (35%) Gaps:105/368 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 WRLMCHRD-EQDSRLRSISMLEQHPGLQPR--MRAILLDWLIEVCEVYKLHRETFYLAVDYLDRY 396
            |:.....| .|..|::.:. |..:....|:  ||....|.|..:...|:|.....:|||..||.:
Zfish    11 WKTQLAADIHQALRIKELK-LPTYQAHSPQIGMRRYFADLLAVLSNRYQLCPTARHLAVYLLDLF 74

  Fly   397 L-HVAHKVQKTHLQLIGITCLFVAAKVEEIYP--PKIGE-----FAYVTDGACTERDILNHEKIL 453
            : |  :.|....|.:|.::||.:|:|.||...  ||:.:     |....:....:||::..|.:|
Zfish    75 MDH--YDVAVRQLYVIALSCLLLASKFEEKEDRVPKLEQLNTLGFMCSLNLTLNKRDLIKMELLL 137

  Fly   454 LQALDWDISPITITGWLGVYMQL-----NVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEFVQ 513
            |:...|::...|...::..|:..     :::|..|  .|.:.:.|:              |....
Zfish   138 LETFGWNLCMPTPAHFIDYYLHAAVQEGDLHNGWP--LSSLSKTKA--------------FMDKY 186

  Fly   514 TSQLLDLCTLDVGMANYSYSVLAAAAISHTFSREMALRCS-----------GLDWQVIQPCARWM 567
            |...|::...|....::..|.:|||.|:   :..:.|:.|           |..|..:..|.:.|
Zfish   187 THYFLEVSLQDHAFLSFRPSQVAAACIA---ASRICLQISPSWTTVLHLLTGYSWDHLTQCIQLM 248

  Fly   568 EPFFRVISQKAPYLQLNEQNEQVSNKFGLGLICPNIVTDDSHIIQTHTTTMDMYDEVLMAQDAAH 632
                         |..::.:.:.:||                              ...:..|..
Zfish   249 -------------LLAHDNDVKEANK------------------------------SKSSPSAGQ 270

  Fly   633 AMRARIQASPATAL----RAPES-----LLT----PPASSHKP 662
            :::.:....|:||.    |.|.|     ||.    |..|.|.|
Zfish   271 SLQPQAHVPPSTAAPSLHRQPTSSSQQLLLQASSYPQLSQHSP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 36/137 (26%)
Cyclin_C <517..>571 CDD:281044 13/64 (20%)
ccnjlNP_001296774.1 Cyclin_N 18..146 CDD:278560 35/130 (27%)
Cyclin_C 148..>254 CDD:281044 22/137 (16%)
STAT6_C 255..>344 CDD:291272 15/89 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.