DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and prss60.1

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:243 Identity:74/243 - (30%)
Similarity:110/243 - (45%) Gaps:24/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 FPWTIAVIHNRSLVG---GGSLITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALEKYPFEEAF 116
            :||.:: :|:....|   |||||..:.||||||.:.......::|..|:... ..:..|..... 
Zfish    45 WPWQVS-LHSPIYGGHFCGGSLINSEWVLTAAHCLPRITTSSLLVFLGKTTQ-QGVNTYEINRT- 106

  Fly   117 VLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQKRSL-SSTRCIVAGWGKYQFS-D 179
            |..:.:|.|:|.....|::|||.|......:..|..:||..|.... :.|...:.|||..|.. :
Zfish   107 VSVITVHPSYNNLTNENDIALLHLSSAVTFSNYIRPVCLAAQNSVFPNGTSSWITGWGNIQLGVN 171

  Fly   180 THYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAG-GEKDNDACTGDGGGALFCPMT 243
            ....|:|::..:|:||...|...|....:..|      :|||| .:...|.|.||.||    ||.
Zfish   172 LPAPGILQETMIPVVPNDQCNALLGSGSVTNN------MICAGLLQGGRDTCQGDSGG----PMV 226

  Fly   244 EDPKQ---FEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQIKENL 288
            .  ||   :.|.||.:||.||.:...|..||.|.:::.||...|.:||
Zfish   227 S--KQCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQSWINSIIVQNL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 71/236 (30%)
Tryp_SPc 50..280 CDD:214473 69/233 (30%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 69/233 (30%)
Tryp_SPc 34..267 CDD:238113 71/236 (30%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.