DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and TPSAB1

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:266 Identity:78/266 - (29%)
Similarity:127/266 - (47%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PDAVKVQFNVTEGQAKP-AEFPWTIAV-IHNRSLVG--GGSLITPDIVLTAAHRIFNKDVEDIVV 96
            |.....:..:..||..| :::||.::: :|....:.  |||||.|..||||||.: ..||:|:  
Human    22 PGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCV-GPDVKDL-- 83

  Fly    97 SAGEWEYGSAL-----EKYPFEEAFVL---KMVIHKSFNYQRGANNLALLFLDREFPLTYKINTI 153
                    :||     |::.:.:..:|   ::::|..|...:...::|||.|:....::..::|:
Human    84 --------AALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTV 140

  Fly   154 CLPTQKRSL-SSTRCIVAGWGKYQFSDTHYGG--VLKKIDLPIVPRHICQDQLRKTRLGQNYT-- 213
            .||....:. ....|.|.|||... :|.....  .||::.:||:..|||.   .|..||. ||  
Human   141 TLPPASETFPPGMPCWVTGWGDVD-NDERLPPPFPLKQVKVPIMENHICD---AKYHLGA-YTGD 200

  Fly   214 ----LPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVF 274
                :...::|||..: .|:|.||.||.|.|.:.   ..:.|.|:|:||.||.:.|.|..||.|.
Human   201 DVRIVRDDMLCAGNTR-RDSCQGDSGGPLVCKVN---GTWLQAGVVSWGEGCAQPNRPGIYTRVT 261

  Fly   275 EFKPWI 280
            .:..||
Human   262 YYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 75/252 (30%)
Tryp_SPc 50..280 CDD:214473 73/250 (29%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 77/257 (30%)
Tryp_SPc 31..267 CDD:214473 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.