DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and Prss55

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:269 Identity:85/269 - (31%)
Similarity:129/269 - (47%) Gaps:26/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ENLQQIEELKCGYGNPDAVKVQFN-VTEGQ-AKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAA 83
            |.|..|...:||.......::|:: :.||| |:..||||.:::..:.....|||:::...:||.|
Mouse    36 ECLLCIASSECGVRPLYDSRIQYSRIIEGQEAELGEFPWQVSIQESDHHFCGGSILSEWWILTVA 100

  Fly    84 HRIFNKDVE--DIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPL 146
            |..:.:::.  |:.|..|.    :.|...|. |..|..::.||.|......|::|||.|.:  ||
Mouse   101 HCFYAQELSPTDLRVRVGT----NDLTTSPV-ELEVTTIIRHKGFKRLNMDNDIALLLLAK--PL 158

  Fly   147 TYKINT--ICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGV-LKKIDLPIVPRHICQDQLRKTRL 208
            |:...|  ||||......|...|.|||||....:|...... |.|:.:.|:....|        |
Mouse   159 TFNELTVPICLPLWPAPPSWHECWVAGWGVTNSTDKESMSTDLMKVPMRIIEWEEC--------L 215

  Fly   209 GQNYTLPRGLICAG-GEKDNDACTGDGGGALFCPMTEDP-KQFEQIGIVNWGVGCKEKNVPATYT 271
            ....:|...::||. |.:..|||.||.||.|.|  |.|| .::.|:||::||..|.:|..|..||
Mouse   216 QMFPSLTTNMLCASYGNESYDACQGDSGGPLVC--TTDPGSRWYQVGIISWGKSCGKKGFPGIYT 278

  Fly   272 DVFEFKPWI 280
            .:.::..||
Mouse   279 VLAKYTLWI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 76/238 (32%)
Tryp_SPc 50..280 CDD:214473 74/236 (31%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 77/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.