DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and LOC683422

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_006252253.1 Gene:LOC683422 / 683422 RGDID:1586868 Length:312 Species:Rattus norvegicus


Alignment Length:289 Identity:92/289 - (31%)
Similarity:141/289 - (48%) Gaps:52/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KCGYGNPDAVKVQFNVTEGQ-AKPA---EFPWTIAVIHNRSLVGGGSLITPDIVLTAAH---RIF 87
            |||.|......:|.||:... .|||   |.||.:.::::.:.:.|||::....||:|:|   :|.
  Rat    28 KCGQGLSTRPLLQENVSAIMGGKPANISEVPWHVGIMNHGTHLCGGSILNEWWVLSASHCFDQIN 92

  Fly    88 NKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINT 152
            |.::|   :..|..:..:...|:  |:  |.|:::|..|:.....|::|||.|  :.||...||.
  Rat    93 NANLE---IRHGRDDLSTKNVKH--EK--VDKLILHPKFDDWLLDNDIALLLL--KSPLNLSING 148

  Fly   153 ICLPTQKRSLSSTR----CIVAGWGKYQFSDTHYGGV------LKKIDLPIVPRHICQDQLRKTR 207
            |.:.|.:  ||..|    |.|.|||     .|:..||      |:|:.:.:.....|        
  Rat   149 IPICTSE--LSDLRIWKNCWVTGWG-----ITNVSGVKVQTTKLQKVQVDLFRWDWC-------- 198

  Fly   208 LGQNYTLP---RGLICAG-GEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPA 268
               .|.||   :.::||| .:...|||.||.||||.|....:...:.|:|||:|||||.:||:|.
  Rat   199 ---GYVLPLLTKNMLCAGTPDGGMDACQGDSGGALVCNKKRNINTWYQVGIVSWGVGCGKKNLPG 260

  Fly   269 TYTDVFEFKPWIVQQI----KENLYTPDN 293
            .||.|..:..||.:|.    |..:|..|:
  Rat   261 VYTKVSPYLKWIRKQTAKAGKPYVYDQDS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 81/252 (32%)
Tryp_SPc 50..280 CDD:214473 79/249 (32%)
LOC683422XP_006252253.1 Tryp_SPc 46..275 CDD:238113 81/255 (32%)
Tryp_SPc 46..272 CDD:214473 79/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.