DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and zgc:123295

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:286 Identity:80/286 - (27%)
Similarity:137/286 - (47%) Gaps:36/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AWTLIVALFVLGVAENVENLQQIEELKCGYGNPDAVKVQFNVTEGQ-AKPAEFPWTIAVIHNRSL 67
            |.|::.||.| .:|.::..|.     .||     ...:...:..|| |....:||.:: :.:.:.
Zfish     6 ALTVVGALLV-NIAGSLCQLN-----VCG-----RAPLNTKIVGGQNAGAGSWPWQVS-LQSPTY 58

  Fly    68 VG---GGSLITPDIVLTAAHRIFNKDVEDIVVSAG-EWEYGSALEKYPFE-EAFVLKMVIHKSFN 127
            .|   |||||..|.||:||| .|...:..|:|..| :.:.||    .|:: ...|::::.|.::|
Zfish    59 GGHFCGGSLINKDWVLSAAH-CFQDSIGTIMVKLGLQSQSGS----NPYQITKTVVQVINHPNYN 118

  Fly   128 YQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSS-TRCIVAGWGKYQFSDTHYGGVLKKIDL 191
            .....|::||:.||........|..:||.....:.:: |...|.||||...:......:|:::::
Zfish   119 NPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVEI 183

  Fly   192 PIVPRHICQDQLRKTRLGQNYTLPRGLICAG--GEKDNDACTGDGGGALFCPMTEDPKQFEQIGI 254
            |||....|    ::...|:   :...:||||  .:...|:|.||.||.:   ::.:..|:.|.||
Zfish   184 PIVSHSDC----KRAYPGE---ITSNMICAGLLDQGGKDSCQGDSGGPM---VSRNGSQWIQSGI 238

  Fly   255 VNWGVGCKEKNVPATYTDVFEFKPWI 280
            |::|.||.|...|..|..|.:::.||
Zfish   239 VSFGRGCAEPGYPGVYARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 69/239 (29%)
Tryp_SPc 50..280 CDD:214473 67/237 (28%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 69/244 (28%)
Tryp_SPc 36..264 CDD:238113 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587474
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.