DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG34458

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:263 Identity:69/263 - (26%)
Similarity:113/263 - (42%) Gaps:54/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VKVQFNVTEGQ-AKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDI--VVSAGE 100
            |..:..:..|| |.|.:||..:::..|.....|||||:..:::||||....::...:  :|...:
  Fly    26 VAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCTMGQNPGQMKAIVGTND 90

  Fly   101 WEYGSALEKYPFEEAF-VLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICL-PTQKRSLS 163
            ...|:.       :.| :.:.:||..:|.|....:::|:.|....|:...:.||.| .:.....:
  Fly    91 LSAGNG-------QTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAA 148

  Fly   164 STRCIVAGWGKYQFSDTHYGGVLKKIDLP---------IVPRHICQDQLRKTRLGQNYTLPRGL- 218
            .|..:::|          :|.:.:.:.||         :..|..|..|          .:| || 
  Fly   149 DTMAMISG----------FGAINQNLQLPNRLKFAQVQLWSRDYCNSQ----------NIP-GLT 192

  Fly   219 ---ICAGGEKDN-DACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPW 279
               :|||..... .:|.||.||    |:|.|.|.|   |:|:||.||..|..||.||.|...:.|
  Fly   193 DRMVCAGHPSGQVSSCQGDSGG----PLTVDGKLF---GVVSWGFGCGAKGRPAMYTYVGALRSW 250

  Fly   280 IVQ 282
            |.|
  Fly   251 IKQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 66/251 (26%)
Tryp_SPc 50..280 CDD:214473 63/247 (26%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 65/254 (26%)
Tryp_SPc 32..254 CDD:238113 68/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.