DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and Prss21

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:317 Identity:91/317 - (28%)
Similarity:136/317 - (42%) Gaps:49/317 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TLIVALFVLGVAENVENLQ----QIEELKCGYGNPDAVK-------VQFNVTEG-QAKPAEFPW- 57
            ||:..|.|:..|...  ||    |::..|.....||.:.       :...:..| .|:...:|| 
Mouse     7 TLVPLLVVVATAAMA--LQSTYLQVDPEKPELQEPDLLSGPCGHRTIPSRIVGGDDAELGRWPWQ 69

  Fly    58 -TIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVE--DIVVSAGE-------WEYGSALEKYPF 112
             ::.|..|.  :.|.:|:....|||||| .|.||.:  |..|..||       |...:...:|..
Mouse    70 GSLRVWGNH--LCGATLLNRRWVLTAAH-CFQKDNDPFDWTVQFGELTSRPSLWNLQAYSNRYQI 131

  Fly   113 EEAFVLKMVIHKSFNY-QRGANNLALLFLDREFPLTYK--INTICLPTQKRSLSS-TRCIVAGWG 173
            |:.|:       |..| ::..|::|||.|..  |:||.  |..|||........: |.|.|.|||
Mouse   132 EDIFL-------SPKYSEQYPNDIALLKLSS--PVTYNNFIQPICLLNSTYKFENRTDCWVTGWG 187

  Fly   174 KY-QFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAG-GEKDNDACTGDGGG 236
            .. :.........|:::.:.|:...:|....:|.....|  :...::||| .|...|||.||.||
Mouse   188 AIGEDESLPSPNTLQEVQVAIINNSMCNHMYKKPDFRTN--IWGDMVCAGTPEGGKDACFGDSGG 250

  Fly   237 ALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQ-QIKENLYTPD 292
            .|.|   :....:.|:|:|:||:||...|.|..||::.....||.. .|:..|..||
Mouse   251 PLAC---DQDTVWYQVGVVSWGIGCGRPNRPGVYTNISHHYNWIQSTMIRNGLLRPD 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 75/250 (30%)
Tryp_SPc 50..280 CDD:214473 73/246 (30%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 74/253 (29%)
Tryp_SPc 55..294 CDD:238113 76/255 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.