DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and zgc:112038

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:272 Identity:80/272 - (29%)
Similarity:124/272 - (45%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGY-------GNPDAVKVQFNVTEGQAKPAEFPWTIAVIHNRS---LVGGGSLITPDIVLTAAHR 85
            ||.       |..|||            ...:||. |.||..|   .:.|||||..|.||:|||.
Zfish    27 CGQAPLNNNNGGDDAV------------AGSWPWQ-ASIHRISPEDHICGGSLINKDWVLSAAHC 78

  Fly    86 IFNKDVEDIVVSAG-EWEYGSALEKYPFEEAFVL-KMVIHKSFNYQRGANNLALLFLDREFPLTY 148
            .......:|.:..| :::.||    .|.|.:..| ::|||..::.....|::|||.|......|.
Zfish    79 FMITATANIKIFLGRQFQTGS----NPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTD 139

  Fly   149 KINTICLPTQKRSLS-STRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNY 212
            .|..:||.:.....: .|:..:.||.|::.||.....||:::.||:|....|....:.       
Zfish   140 YIRPVCLASADSVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNADYKG------- 197

  Fly   213 TLPRGLICAG-GEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEF 276
            .:...:|||| .|...|||.||.||.:   ::::..::.|.|||::|..|.....|..||.|.::
Zfish   198 IITDNMICAGINEGGKDACQGDSGGPM---VSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQY 259

  Fly   277 KPWIVQQIKENL 288
            :.||..:::.||
Zfish   260 QSWITSELRTNL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 72/239 (30%)
Tryp_SPc 50..280 CDD:214473 70/236 (30%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 74/252 (29%)
Tryp_SPc 37..263 CDD:238113 74/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.