DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and Tpsab1

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:274 Identity:84/274 - (30%)
Similarity:126/274 - (45%) Gaps:35/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PDAVKVQFNVTEGQ-AKPAEFPWTIAVIHNRSL---VGGGSLITPDIVLTAAHRIF-NK-DVEDI 94
            |.....:..:..|| |...::||.:::..|.:.   ..|||||.|..||||||.:. || |...:
  Rat    57 PSLAMPREGIVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNKL 121

  Fly    95 VVSAGEWEYGSALEK---YPFEEAFVLKMVI-HKSFNYQRGANNLALLFLDREFPLTYKINTICL 155
            .|.         |.|   |..:....:..:| |..|...:...::|||.|.....:|..::|:.|
  Rat   122 RVQ---------LRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSL 177

  Fly   156 PTQKRSL-SSTRCIVAGWGKYQFSDTHYGG--VLKKIDLPIVPRHICQDQLRK-TRLGQNYTLPR 216
            |....:. |.|.|.|.|||... :|.....  .|:::.:|||...:|..:..| ...|.|..:.|
  Rat   178 PPASETFPSGTLCWVTGWGNIN-NDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHIVR 241

  Fly   217 -GLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI 280
             .::|||.| .:|:|.||.||.|.|.: ||  .:.|.|:|:||.||.:.|.|..||.|..:..||
  Rat   242 DDMLCAGNE-GHDSCQGDSGGPLVCKV-ED--TWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 302

  Fly   281 VQQIKENLYTPDNY 294
            .:      |.|.::
  Rat   303 YR------YVPKDF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 79/246 (32%)
Tryp_SPc 50..280 CDD:214473 77/243 (32%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 79/249 (32%)
Tryp_SPc 66..302 CDD:238113 79/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346371
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.