DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and prss60.2

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:269 Identity:83/269 - (30%)
Similarity:120/269 - (44%) Gaps:48/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NVTEGQAKPAEFPWTIAVIHNRSLVG----GGSLITPDIVLTAAHRIFNKDVEDIVVSAG-EWEY 103
            |..||     .:||.:::...|  .|    |||||:.:.||||||.:.......:||..| ..:.
Zfish    39 NAPEG-----SWPWQVSLQSPR--YGGHFCGGSLISSEWVLTAAHCLPGVSESSLVVYLGRRTQQ 96

  Fly   104 GSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSS-TRC 167
            |....:   ....|.|:::|.|:|.....|::|||.|.........|..:||..|....|: |..
Zfish    97 GVNTHE---TSRNVAKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPVCLAAQNSVYSAGTSS 158

  Fly   168 IVAGWGKYQFSDTHYG------GVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGEK- 225
            .:.|||     |...|      |:|::..:|:|....|..|     ||.. |:...:||||..| 
Zfish   159 WITGWG-----DVQAGVNLPAPGILQETMIPVVANDRCNAQ-----LGSG-TVTNNMICAGLAKG 212

  Fly   226 DNDACTGDGGGAL---FCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQIKEN 287
            ..|.|.||.||.:   .|.:      :.|.||.:||.||.:.|.|..||.|.:::.||..:|.:|
Zfish   213 GKDTCQGDSGGPMVTRLCTV------WIQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKISQN 271

  Fly   288 -----LYTP 291
                 |:||
Zfish   272 QPGFILFTP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 75/248 (30%)
Tryp_SPc 50..280 CDD:214473 73/245 (30%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 76/251 (30%)
Tryp_SPc 34..267 CDD:238113 78/254 (31%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.