DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and Prss44

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:244 Identity:83/244 - (34%)
Similarity:137/244 - (56%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KPA---EFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALE-KYP 111
            |||   ::||.:::..::..:.|||||:...|:||||.::..  .|.|||.||.:..|::. |.|
  Rat   117 KPAPIRKWPWQVSLQVHKQHICGGSLISKWWVMTAAHCVYGH--LDYVVSMGEADLWSSMSVKIP 179

  Fly   112 FEEAFVLKMVIHKSFNYQRG-ANNLALLFLDREFPLTYKIN--TICLPTQKRSL--SSTRCIVAG 171
            .::     :::|:.::..|. .:::||:.|  .||:.|.:|  .:|:| :|..|  ..|.|.|.|
  Rat   180 VQD-----IIVHQDYSVMRTIVHDIALVLL--AFPVNYSVNIQPVCIP-EKSFLVQPGTLCWVTG 236

  Fly   172 WGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTL-PRGLICAGGEKDNDACTGDGG 235
            ||| .........||:::||.|: ||...:|:.|...|:.:|| ..|.:|...:|..|||.||.|
  Rat   237 WGK-TIERGRSSRVLREVDLSII-RHERCNQILKDITGRIFTLVQEGGVCGYNKKGGDACQGDSG 299

  Fly   236 GALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQI 284
            |.:.|   |..|.:.|:|||:||:||.....|..||:|..::.||::::
  Rat   300 GPMVC---EFNKTWVQVGIVSWGLGCGRIGYPGIYTEVSYYRDWIIKEL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 83/241 (34%)
Tryp_SPc 50..280 CDD:214473 81/238 (34%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 81/238 (34%)
Tryp_SPc 113..341 CDD:238113 81/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.