DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG9733

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:282 Identity:77/282 - (27%)
Similarity:125/282 - (44%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGYGNPDAVKVQFNVTEGQAKPA-EFPWTIAVIHNR------SLVGGGSLITPDIVLTAAHRI-- 86
            ||     .|.::..:.:||.... ||||.:.:.:.|      |....||||....||||||.:  
  Fly   153 CG-----GVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTG 212

  Fly    87 -FNKDVEDIV-VSAGEWEYGSALEKYP-------------FEEAFVLKMVIHKSFNYQRGANNLA 136
             ..::|..:| |..||.:..:|::..|             |||..|.:....|:.|.   .:::.
  Fly   213 RIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQ---VHDIG 274

  Fly   137 LLFLDREFPLTYKINTICLPTQ---KRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHI 198
            |:.::|....:..|..||||:.   :...|..:..|||||:  ........|.:|:.:..|....
  Fly   275 LIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGR--TLKMARSAVKQKVTVNYVDPAK 337

  Fly   199 CQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKE 263
            |:.:..:.::....|    .:||||:...|:|.||.||.|   |....:.:...|||::|..|..
  Fly   338 CRQRFSQIKVNLEPT----QLCAGGQFRKDSCDGDSGGPL---MRFRDESWVLEGIVSFGYKCGL 395

  Fly   264 KNVPATYTDVFEFKPWIVQQIK 285
            |:.|..||:|..:..||.|.::
  Fly   396 KDWPGVYTNVAAYDIWIRQNVR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 71/259 (27%)
Tryp_SPc 50..280 CDD:214473 69/256 (27%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 71/262 (27%)
Tryp_SPc 162..415 CDD:238113 73/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.