DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG9737

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:267 Identity:76/267 - (28%)
Similarity:116/267 - (43%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EFPWTIAVIHNRSLVG-GGSLITPDIVLTAAHRIFNKDVEDIV----VSAGEWEYGSALEKYPFE 113
            ||||...:::|.:..| .|:||....:|||||.:..:.|.|..    |..|  |:....|....|
  Fly   160 EFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLG--EFNVKTEPDCIE 222

  Fly   114 EAFVL------------KMVIHKSF----NYQRGANNLALLFLDREFPLTYKINTICLPTQKRSL 162
            |...|            |:.:|..:    ||:  .|::|::.|......|:.:..||||.:...|
  Fly   223 EPNYLSCADAALDIAYEKIHVHPEYKEFSNYK--YNDIAIIRLKHPVSFTHFVMPICLPNKSEPL 285

  Fly   163 S---STRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGE 224
            :   .....|:|||:....:.::..:...|.|.:...::..:...|...|....|....||||||
  Fly   286 TLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVRLGPKQICAGGE 350

  Fly   225 KDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWG-VGCKEKNVPATYTDVFEFKPWI---VQQIK 285
            ...|.|.||.||.|.. ......::...|:|::| ..|.....||.||:|.|:..||   |||.|
  Fly   351 FAKDTCAGDSGGPLMY-FDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQRK 414

  Fly   286 ENLYTPD 292
            ::..|.|
  Fly   415 KSQQTQD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 71/256 (28%)
Tryp_SPc 50..280 CDD:214473 68/250 (27%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 68/250 (27%)
Tryp_SPc 150..409 CDD:238113 70/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.