DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG17404

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:267 Identity:71/267 - (26%)
Similarity:105/267 - (39%) Gaps:57/267 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PDAVKVQFNVTEGQAKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDIVVSAGE 100
            |..|.:|:....||            :|    ..|||:|.|:.:|||||.....:...:.|.||.
  Fly    48 PYQVSLQYRTRGGQ------------MH----FCGGSIIAPNRILTAAHCCQGLNASRMSVVAGI 96

  Fly   101 W---EYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYK-INTICLPTQKRS 161
            .   |.||..:        ||...||..:. :...::||:|.:.....|... |:.|...:|.:.
  Fly    97 RGLNEKGSRSQ--------VLSYSIHPKYQ-ELVTSDLAVLSIKPPLKLNNSTISAIEYRSQGKD 152

  Fly   162 L--SSTRCIVAGWG-----KYQFSD-THYGGVLKKIDLPIVPRHICQ----DQLRKTRLGQNYTL 214
            .  ......:.|||     .:.|.| .:|..||:::....:....|:    :.:..|.       
  Fly   153 FVGGGVPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNSECRNAGMESVTDTE------- 210

  Fly   215 PRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWG-VGCKEKNVPATYTDVFEFKP 278
                |||.| ....||:||.||.|   :.|.....:|:|||::| |.|.....|..||.|..|..
  Fly   211 ----ICARG-PFRGACSGDSGGPL---VMESKNGLQQVGIVSYGLVVCGLYISPDVYTRVSTFSD 267

  Fly   279 WIVQQIK 285
            ||..|.|
  Fly   268 WIGNQTK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 64/249 (26%)
Tryp_SPc 50..280 CDD:214473 62/246 (25%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 67/260 (26%)
Tryp_SPc 35..269 CDD:238113 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.