DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and Sp7

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:298 Identity:84/298 - (28%)
Similarity:125/298 - (41%) Gaps:76/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KCG---------YGNPDAVKVQFNVTEGQAKPAEFPWTIAVIH------NRSLVGGGSLITPDIV 79
            |||         .||..|:.             ||.| :|::.      .|.|..|||||....|
  Fly   127 KCGPHSFSNKVYNGNDTAID-------------EFNW-MALLEYVDNRGRRELSCGGSLINNRYV 177

  Fly    80 LTAAHRIFNKDVEDI----VVSAGEWEYGSALE------KYPFEEAFVLKMVIHKSF---NYQRG 131
            |||||.:......::    .|..||::....::      ..|..:..:.:..:|..:   |..| 
  Fly   178 LTAAHCVIGAVETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNR- 241

  Fly   132 ANNLALLFLDREFPLTYKINTICLPTQKRSLSSTR--------CIVAGWGKYQFSDTHYGGVLKK 188
            .:::|||.|||...|...|..:|||     |.|||        .:|:|||:  .:......:.::
  Fly   242 IHDIALLRLDRPVVLNEYIQPVCLP-----LVSTRMAINTGELLVVSGWGR--TTTARKSTIKQR 299

  Fly   189 IDLPIVPRHICQDQLRK--TRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQ 251
            :|||:.....|   .||  ||   |..|....:|.|||...|:|.||.||.|.      .:.|:|
  Fly   300 LDLPVNDHDYC---ARKFATR---NIHLISSQLCVGGEFYRDSCDGDSGGPLM------RRGFDQ 352

  Fly   252 I----GIVNWGVGCKEKNVPATYTDVFEFKPWIVQQIK 285
            .    |:|::|..|..:..|..||.|.::..|||:.|:
  Fly   353 AWYQEGVVSFGNRCGLEGWPGVYTRVADYMDWIVETIR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 77/265 (29%)
Tryp_SPc 50..280 CDD:214473 74/262 (28%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 77/282 (27%)
Tryp_SPc 137..388 CDD:238113 80/284 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.